Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2w26-ps Olfactory Receptor

Gene Symbol Or2w26-ps
Organism Rat
Family 2
Subfamily w
Pseudo Yes
Location chr10:44606511-44607605 (+)
Aliases Olr1447-ps

Sequence information


Nucleotide sequence

CACGAATGGGTCATTTTTTCCAGAAATTTAAGTATCATTAGTAATGTTGAATTAATTTAT
TTGTCTCTTTGTTTTTTCCTCTTCCCCATGTGCAATAGAGATGGGCGCAGTGAACGACAG
CACCTTCAGCCATTTCATCTTTATAGGCTTCACTGACTGGCCCCAGCTGGAGAGGGTCCA
CTTCACCATCATTCTGTCTGCCTACCTTTTGATCCTGCTAGGCAACAGCACCATCATCCT
GGTGTCCAGTCTGGACCCACACCTGCACACCCCCATGTACTTCTTCCTCAGTTCTTTCTG
GACCCCACCTTCACCAGTAGCTCCATACCACAGCTGCTCTATAACCTCAGCGGGCCGGAC
AAGACCATCAGCTACATGGGTTGTGCTCTGCACCTGGTCCTGTTCCTAGGCCTGGGGTGT
GTGGAGCGCCTGCTGCTGGCTGTCATGGCCTATGACCACTTTGTGGCAGTCTGCAAGCTC
CCACACTACATCATCTTCATAAGTCCAAGGCTCTGTAGAATTTTAGTGTCTCTTGCTTGA
GGTATGGTGTGGTCAACTTTTTGATTATGTCCCCAAGGACCTTGTGGTTGCCTCATTATG
GGTATTTCAGAGTAGACCACTTTTTCTGTGAAATGCCAGCCCTCATCAAGATGGCCTGTA
CCAGCACAACCGTTGGTGAAGGCTTTACTTTCCTCCTGGAAATAGGCATTGTGCTGTCCC
ATCTGGGGTTCATCTTGTTTTCTTATTTCTAAATCATGAGGGCTGTGTCTTGTATGCAGT
TGTCCCCAGGAAGGCACAAAATCTTCTACACCTGTGGCTTGCATAGTCTTGCCCTTCTAC
GGAAATATCATCTGGATGTTCATGTGGCCAGGGAACAGCTCCTCCCAGGACCAAGGCAAA
TTCCTCACCCTCTTCTAAAACATTGTGACCTCTTCCTCAACCATCTGATCTACACACTCA
GGAACAAGGAAGTGAAGGGATGCTTAGGAGGCTGATTTGAGGAAATGTAAGTTTAACAAA
GAAATTATAATTAAGGGCAAAGCTAAGACCGCTCAAAGGGTAAAACCTTACAAAATATGT
TCAATATCACTAACA


Conceptual translation

MGAVNDSTFSHFIFIGFTDWPQLERVHFTIILSAYLLILLGNSTIILVSSLDPHLHTPMY
FFLSS/LDPTFTSSSIPQLLYNLSGPDKTISYMGCALHLVLFLGLGCVERLLLAVMAYD
HFVAVCKLPHYIIFISPRLCRILVSLA/RYGVVNFLIMSPRTLWLPHYGYFRVDHFFCE
MPALIKMACTSTTVGEGFTFLLEIGIVLSHLGFILFSYF*IMRAVSCMQLSPGRHKIFYT
CGLH\LPFYGNIIWMFMWPGNSSSQDQGKFLTLF*NIVTS/LNHLIYTLRNKEVKGCL
GG