Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2y15 Olfactory Receptor

Gene Symbol Or2y15
Organism Rat
Family 2
Subfamily y
Pseudo No
Location chr10:34662186-34663118 (+)
Aliases Olr1393

Sequence information


Nucleotide sequence

ATGGGAAATTTCAACACCAGTTCACAAGAGAGTTTCATTTTGGTGGGTTTCTCAGATTGG
CCTCAACTGCAAGTCTTTCTTTTTGTCATTATTTTGATTTTCTACTCCCTAACGATCTTT
GGCAATACTACCATCATCATACTTGCAAGACTAGACTTACGGCTACACAAACCTATGTAC
TTTTTCCTCTCCCATCTGTCCTTCCTGGACCTCTGCTACACCACCAGCACCGTGCCCCAG
CTTCTGATCAACCTTTACGGACTCGACAGGACCATCAGCTACGGAGGATGTGTGGCACAA
CTCTTCATTTTCCTTGCTCTGGCCTCCACAGAATGTTTGATTTTGGTGGCAATGGCCTTC
GACCGCTATGCTGCTGTGTGTCATCCACTCCACTACACCAGCATTATGCACCCCATCCTC
TGCAGGGCATTGGCCATCTCCTCCTGGGTGGGAGGCCTTGTGAACTCTCTGATCCAGACA
GGGCTTGTGATGGCCATGCGACTCTGTGGCCATCAAATCAATCACTTCTTCTGTGAGATG
CCCATATTCCTGAAGTTGGCCTGTGAGGACACAGGAGGAACAGAAGTTAAGATGTTTGTG
GCTCGAACAATAGTCTTGGTTTGCCCTGCAGTACTGATACTAGGCTCCTATGTTCACATT
GCTAAGGCTGTACTGAAAGTCAAGTCAATGGCTGGGCGCAGAAAGGCTTTTGGGACTTGT
GGGTCCCATCTCATGGTGGTTTCTCTCTTTTATGGCTCAGGTATTTATACATATCTTCAA
CCAGTCCACAAGTATTCTGAAAGCAAGGGAAAGTTTGTTGCCCTCTTTTATACTATTGTT
ACCCCCATGTTCAATCCTTTGATCTATACCCTGAGGAACAAGGAAGTGAAGGGGGCTCTG
TGGAAGATGCTAGGGAGAGGCACAGATTCGGGG


Conceptual translation

MGNFNTSSQESFILVGFSDWPQLQVFLFVIILIFYSLTIFGNTTIIILARLDLRLHKPMY
FFLSHLSFLDLCYTTSTVPQLLINLYGLDRTISYGGCVAQLFIFLALASTECLILVAMAF
DRYAAVCHPLHYTSIMHPILCRALAISSWVGGLVNSLIQTGLVMAMRLCGHQINHFFCEM
PIFLKLACEDTGGTEVKMFVARTIVLVCPAVLILGSYVHIAKAVLKVKSMAGRRKAFGTC
GSHLMVVSLFYGSGIYTYLQPVHKYSESKGKFVALFYTIVTPMFNPLIYTLRNKEVKGAL
WKMLGRGTDSG