Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or2y3-ps Olfactory Receptor

Gene Symbol Or2y3-ps
Organism Rat
Family 2
Subfamily y
Pseudo Yes
Location chr20:628751-629470 (+)
Aliases Olr1685-ps

Sequence information


Nucleotide sequence

CCCCAGATGCTGAAAAATATACAGAGCCACGAGAGAAGCATCAGCTATGTGGGCTGCATA
GCACAACTCTTCATCTTCCTTAGCCTGGGATCTACAGAATGTGTGCTTCTCTCCATCATG
GCCTTTGATCGGTATGTGGCTATCTGCCACCCTCTGCGTTACACAGTTATCATGCACTCC
CGGCTGTGCCAACAGCTGGCAGCAGTATCTTGGGTAACTGGTTTCAGCAACTCTTTGGTA
CAGACAGAGTTGACTTCTTTGTTGCCTCGTTGTGGCCAATACCAGGTAGAGAATTTCTTC
TGTGAGGTACCTGCCATGCTTCAGTTATCCTGTGTTGACACCTGGGTCAATGAGGTAGAG
ATGTATGCTGCAGTAGTTGTCATAAAAGTTATCCCTCTTGGGCTAATTCTTTTCTCTTAC
ATCAACATTGTCAGAGCAGTCATGAGGATACAATCTTCTGAAGGTCGGAAGAAGGCCTTT
AACACATGTGGGTCTCATCTTCTGGTGGTCATCATGTTTTATGGCTCTGCCATCAGTGGC
TATGCATACATGGCACCCAAGAGCAGCTCAGCCAAACTTAAGGGCAAGCTTTTGGCACTG
TTCTATGGACTCATAACCCCAATGCTGAACCCTCTTATCTATACCTTGAGGAACAAGGAT
GTCAAGGCAGCAGTGAAGAAGGTACTTGGAAGAGAACAAGAGCAAGGGTGGAACTTGGAT


Conceptual translation

MRRFNNTPHHTNGFILVGFSEWPRLEMALLVVISIFYIVTLFGNSAIIILSRLDPKLHTP
MYFFLANLSVLDLCYTTSTVP\MLKNIQSHERSISYVGCIAQLFIFLSLGSTECVLLSI
MAFDRYVAICHPLRYTVIMHSRLCQQLAAVSWVTGFSNSLVQTELTSLLPRCGQYQVENF
FCEVPAMLQLSCVDTWVNEVEMYAAVVVIKVIPLGLILFSYINIVRAVMRIQSSEGRKKA
FNTCGSHLLVVIMFYGSAISGYAYMAPKSSSAKLKGKLLALFYGLITPMLNPLIYTLRNK
DVKAAVKKVLGREQEQGWNLD