Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or3a10-ps Olfactory Receptor

Gene Symbol Or3a10-ps
Organism Rat
Family 3
Subfamily a
Pseudo Yes
Location chr10:60929316-60930462 (-)
Aliases Olr1508-ps

Sequence information


Nucleotide sequence

CCATGTAGATGCTGATGACACGTTCACATGTGCCTCTTTCATTCACTATTTGTGAGATCT
AACTCTTCCTCCCTTGCCCTCCAGCTCATAGCAGTGGCCTATGGAGCCAGGAGCCTGAGG
AAACAGGACAGCTGTCACCGAATTCATCCTTCTTGGCTTAACAGGAAATGTAAGACTGCA
CTCTATCCTTTTTGTTGTCTTTTTCTTTGCCTATATTGTCACAGTTGGGGGTAACTTCAG
CATTTTGGCTCCCATCTTTGTGGAACCCAAGCTCCACACTCCTATGTACTACTTCTTGGG
GAATCTATCTCTGTTGGACATCAGATGCATCAGTGTCACTGTTCCTCCAATGCTGGTGTG
TCTCCTGGCTCACGAGTGCAGAGTTCCCTACGCTGCCTGCATATCACAGCTCTTTTTTTC
CACCTCCTGGCAGGTGTGAACTGTCATCTCTTGACAGCCATGGCCTATGATCGCTACCTG
GCCATCTGCCAGCCCCTCACCTATAGCACCCGCATGAGCCGTGAAGTGTAGGGCACACTG
GTGGGTATTTGCTGCACTGTCTCCTTCATTAATGCTCTGACTCACACAGTGGCTGTGTCT
GTGCTGGACTTCTGCGGCCCTAATGTGGTCAACCACTTCTACTGTGACCTCCCACCCCTT
TTCCAGCTCTCCTGCTCCAGCATCTACCTCAACGGGCAGCTGCTTTTTGTGGGAGCCACT
TTCATGGGAGTAGTCCCTATGATACTGATCTCAGTGTCCTATGCCCATGTTACAGCTGCA
GTACTAAAGATCCGCTCCACAGAGGGGAGGAAGAAATCATTTTCTACATGTGGCTCCCAC
CTCACTGTGGTCTGTATCTTTTATGGAACTGGCTTCTTTAGTTACATGCGTCTGGGTTCC
GTCTCAGCCTCAGACAAGGACAAGGGCATTGGGATCCTCAATACTATCCTCAGCCCTATG
TTAAACCCACTCATATACAGCCTCTGAAACCCGGATGTACAGGGTGCCCTGAAGAGGATG
CTGACAGGAAAGAGGCATCCAGTGTGAGAACACAGGACAAGGGTATCAAAATATCCAGCC
ATCTTTACATATGCCCTTGGCATTCTCACACTGGAAGCTCAAGTGCACAGTTGGAGGAAT
TCTTCAG


Conceptual translation

MEPGA*GNRTAVTEFILLGLTGNVRLHSILFVVFFFAYIVTVGGNFSILAPIFVEPKLHT
PMYYFLGNLSLLDIRCISVTVPPMLVCLLAHECRVPYAACISQL/FFHLLAGVNCHLLT
AMAYDRYLAICQPLTYSTRMSREV*GTLVGICCTVSFINALTHTVAVSVLDFCGPNVVNH
FYCDLPPLFQLSCSSIYLNGQLLFVGATFMGVVPMILISVSYAHVTAAVLKIRSTEGRKK
SFSTCGSHLTVVCIFYGTGFFSYMRLGSVSASDKDKGIGILNTILSPMLNPLIYSL*NPD
VQGALKRMLTGKRHPV