Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or3a1c Olfactory Receptor

Gene Symbol Or3a1c
Organism Mouse
Family 3
Subfamily a
Pseudo No
Location chr11:74,155,200-74,156,100 (+)
Aliases Olfr402

Sequence information


Nucleotide sequence

MQTKPRINGTTITEFILLGLVETPELWPLVFILFLLAYMTTVGGNLSILAAVLVEPKLHT
PMYFFLGNLSVMDVGCISVTIPSMLVRLLVQKHTIPYGDCLTQLFFFHLLAGVDCFLLTA
MAYDRFLAICQPLTYSTRMNYTIQRILVAMSWACAFSNALTHTVAISTLHFCGPNVINHF
YCDLPQLFQLSCSSTQLNELLLFGVGFIMAGTPMALIFISYIHVAAAVLRIRSAEGRKKA
FSTCSSHLTVVAMFYGTGMFNYMRLGSTKFSDKDKAIGIFNTVINPMLNPLIYSLRNPDV
QAALWRVLTGRRPAA


Conceptual translation

MQTKPRINGTTITEFILLGLVETPELWPLVFILFLLAYMTTVGGNLSILAAVLVEPKLHT
PMYFFLGNLSVMDVGCISVTIPSMLVRLLVQKHTIPYGDCLTQLFFFHLLAGVDCFLLTA
MAYDRFLAICQPLTYSTRMNYTIQRILVAMSWACAFSNALTHTVAISTLHFCGPNVINHF
YCDLPQLFQLSCSSTQLNELLLFGVGFIMAGTPMALIFISYIHVAAAVLRIRSAEGRKKA
FSTCSSHLTVVAMFYGTGMFNYMRLGSTKFSDKDKAIGIFNTVINPMLNPLIYSLRNPDV
QAALWRVLTGRRPAA