Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or3a1g-ps Olfactory Receptor

Gene Symbol Or3a1g-ps
Organism Rat
Family 3
Subfamily a
Pseudo Yes
Location chr10:60956422-60956802 (+)
Aliases Olr1510-ps

Sequence information


Nucleotide sequence

CCTGTAGCTAAAGCCAATGGAACCACTGTTGCTGAGTTCATTCTGCTGGGTTTGGTGGAG
ATACCAGAGGTGTGGCCAGTTGTTGTCATACTCTTCCTCTTGGCTTATATGATAACAGTT
GGGGGCAACCTCAGCATCCTGGCAGCTGTCTTGGTAGAACCCAAACTGCACACGCCCATG
TACTTCTTCCTGGGGAATCTGTCAGTGATGGGTGTGGGGTGCATCAGTGTCACTATTCCC
TCCATGTTGGTTCGGCTCTTGCCCCACAAGCTTACAGTTCCATATGGAGACTGCCTCACA
CAACTCTTCTTTTTCCATCTCCTGGCTGGGGTTGACTGCTTCCTGTTGACAGCCATGGCA
TATGACTGCTTCCTGGTCATC


Conceptual translation

PVAKANGTTVAEFILLGLVEIPEVWPVVVILFLLAYMITVGGNLSILAAVLVEPKLHTPM
YFFLGNLSVMGVGCISVTIPSMLVRLLPHKLTVPYGDCLTQLFFFHLLAGVDCFLLTAMA
YDCFLVI/LTLTYSN*MKHTVQSVLVAMSWACAFSNALTHTVAISILYFCGPNVINNFY
CDLPQLFQLSCSSTQFKKLLI/GVGFIMSGTPMAPIFISYIHVAAAVLLICSAEGRKKA
F\TCSSHLTVVATFYGIGIFAYMRLGSVKLSDKDKAIGIFNSVINLMLNQL/YSLSNP
DVQAVLWRVLTRRWLS