Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a15 Olfactory Receptor

Gene Symbol Or4a15
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89362486-89363427 (-)
Aliases Olfr1234, RP24-427F7.3, MOR231-2, RP24-427F7.3, MOR231-2

Sequence information


Nucleotide sequence

ATGGAAAACAGGAACAATGTGACTGAATTTATCCTTCTGGGCCTCACTCAGAATCCAGAA
GGCCAAAAGGTTCTGTTTGTCACATTCTTGCTCATCTACATTGTGACAGTAATGGGCAAT
CTGCTCATCATGGTGACCATCATGGCTAGCCACTCCCTCGGCTCTCCTATGTACTTCTTT
CTGGCTTATTTGTCATTTATAGATACTGTCTATTCTACTTCCATTGCTCCCAAAATGATT
ATTGACTTGCTCTATGAAACAAAGACCATCTCCTTCCGGGCTTGTATGACTCAAGTTTTT
ATAGATCATTTATTTGCTGGAGCTGAGGTTATTCTTCTGGTGGTGATGGCCTATGACCGT
TATGTGGCCATCTGTAAACCTCTTCATTATTTGACCATCATGAATCGACGAGTGTGTGTT
CTCATGCTGCTGGGGGCCTGGATTGGTGGCTTTCTTCACTCATTAATTCAATTTATCTTC
ATTTATCAGCTTCCTTTCTGTGGCCCAAATATCATTGATAGCTTTGTATGTGATATGTAT
CCTCTGCTAAAACTGGCTTGCACCAATACCTACCTTATAGGGCTTTGTATGATTGCTAAT
GGAGGAGCAATTTGTACCGTCACCTTTTTAATTCTCCTAGTTTCTTATGGAGTCATTTTA
CACTCCCTTAAGGCACATAGTCTGGAAGGGAAGCGCAAAGCTTTGTACACATGTGCATCC
CACATTACTGTGGTTGTTTTATTCTTTGTTCCATGCATCTTTCTATATGCAAGGCCTACA
TCCACATTTCCAATTGATAAGTCTGTGACTGTTGTCTTAACTTTCATAACTCCGATGCTG
AACCCCTTAATCTACACCTTGAGGAATGCAGAAATGAAAAATGCTATGAAGAGACTTTGG
AGCAAAAAATCTAGCTCCATCGTAAGTGGGCTATATCACTCT


Conceptual translation

MENRNNVTEFILLGLTQNPEGQKVLFVTFLLIYIVTVMGNLLIMVTIMASHSLGSPMYFF
LAYLSFIDTVYSTSIAPKMIIDLLYETKTISFRACMTQVFIDHLFAGAEVILLVVMAYDR
YVAICKPLHYLTIMNRRVCVLMLLGAWIGGFLHSLIQFIFIYQLPFCGPNIIDSFVCDMY
PLLKLACTNTYLIGLCMIANGGAICTVTFLILLVSYGVILHSLKAHSLEGKRKALYTCAS
HITVVVLFFVPCIFLYARPTSTFPIDKSVTVVLTFITPMLNPLIYTLRNAEMKNAMKRLW
SKKSSSIVSGLYHS