Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a15 Olfactory Receptor

Gene Symbol Or4a15
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78215418-78216338 (-)
Aliases Olr697, Olr697

Sequence information


Nucleotide sequence

ATGGAAAAGAATAATGTGACTGAATTTATCCTCCTGGGCCTCACCCAGAACCCAGAGGGC
CAAAAGATTCTGTTTGTCACATTCTTGCTCATCTACATCGTGACAGTAATGGGCAATCTG
CTCATAATGGTGACCATCATGGCTAGCCAGTCCCTTGGTTCCCCTATGTACTTTTTCCTG
GCTTATTTGTCATTTATAGATACTGTCTATTCTACTGCCATTGCTCCCAAAATGATTATT
GACTTGCTCTATGAAACAAAGACCATCTCCTTCCGGGCTTGTATGACTCAAGTTTTTATA
GATCATTTATTTGCTGGAGCTGAGGTCATTCTTCTGGTGGTGATGGCCTATGACCGCTAT
GTGGCCATCTGTAAGCCTCTTCATTATTTGACTGTCATGAATCGGCGGGTATGTGTTCTC
ATGCTGTTGGGAGCCTGGATTGGTGGCTTTCTTCACTCATTAATTCAATTTATTTTCATT
TATCAGCTCCCTTTCTGTGGCCCAAATATCATTGACAGCTTTGTATGTGATATGTATCCT
TTGCTAAAACTAGCCTGCACCAATACTTACCTCATAGGGCTTTGTATGATCGCTAATGGA
GGGGCAATTTGCACTGTTACTTTTTTAATTCTCCTAGTTTCTTATGGGGTCATTTTACAC
TCTCTAAAGGCACATAGTCTGGAAGGGAAGCGCAAAGCTTTGTACACATGTGCATCCCAC
ATCACTGTAGTCGTTTTGTTCTTTGTTCCATGCATCTTCCTATATGCAAGGCCTACATCC
ACATTTCCCATTGATAAGTCTGTTACTGTTGTCTTAACTTTCATAACTCCAATGCTGAAC
CCCTTAATCTACACCTTGAGGAATGCAGAAATGAAAAATGCTATGAAGAAACTTTGGAGA
AAAAAAAATCTAGCTCCATTG


Conceptual translation

MEKNNVTEFILLGLTQNPEGQKILFVTFLLIYIVTVMGNLLIMVTIMASQSLGSPMYFFL
AYLSFIDTVYSTAIAPKMIIDLLYETKTISFRACMTQVFIDHLFAGAEVILLVVMAYDRY
VAICKPLHYLTVMNRRVCVLMLLGAWIGGFLHSLIQFIFIYQLPFCGPNIIDSFVCDMYP
LLKLACTNTYLIGLCMIANGGAICTVTFLILLVSYGVILHSLKAHSLEGKRKALYTCASH
ITVVVLFFVPCIFLYARPTSTFPIDKSVTVVLTFITPMLNPLIYTLRNAEMKNAMKKLWR
KKNLAPL