Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a15b Olfactory Receptor

Gene Symbol Or4a15b
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78234816-78235847 (-)
Aliases Olr698, Olr698

Sequence information


Nucleotide sequence

ATGAAACTTAAGATCACTTCAAATTCAGCATCCACTCTGTCTGCAGGCTCTGGCATCTTT
ATGAGTTCAACACTCTCAGAAGAGCATATGGAAAAGAATAATGTGACTGAATTTATCCTC
CTGGGCCTAACCCAGAACCCAGAGGGCCAAAAGATTCTGTTTGTCACATTCTTGCTCATC
TACATTGTGACAGTAATGGGCAATCTGCTCATCATGGTGACCATCATAGCTAGCCAGTCC
CTTGGTTCCCCTATGTACTTTTTCCTGGCTTATTTGTCATTTATAGATACTGTCTATTCT
ACTGCCATTGCTCCCAAAATGATTATTGACTTGCTCTATGAAACAAAGACCATCTCCTTT
CGGGCTTGTATGACTCAAGTTTTTATAGATCATTTATTTGCTGGAGCTGAGGTCATTCTT
CTGGTGGTGATGGCCTATGACCGCTATGTGGCCATCTGTAAGCCTCTTCATTATTTGACC
GTCATGAATTGGCGGGTATGTGTTCTCATGCTGTTGGGAGCCTGGATTGGTGGCCTTCTT
CACTCACTAATTCAATTTATTTTCATTTATCAGCTCCCTTTTTGTGGTCCAAACATAATT
GACAACTTTCTGTGTGACATTTATCCTTTGCTAAAACTAGCTTGCACCAATACTTACCTC
ATTGGGCTTTGTATGATCGCTAATGGAGGGGCAATTTGCACTGTCACATTCTTAATACTT
TTAGTTTCTTATGGGGTCATTTTACACTCTCTAAAGGCACATAGTCTGGAAGGGAAACGC
AAAGCTTTGTACACATGTGCTTCCCACATTGCTGTGGTCATTTTATTCTTCGTTCCCTGT
ATCTTCTTGTTTGCCAGGCCTACATCCACATTTCCCATTGATAAGTGTGTGACTGTAGTT
TTAACTTTAATTACTCCAATGTTGAACCCCTTAATCTACACCCTGAGGAATGCAGAAATG
AAAAATGCCATGAGGAGACTTTGGACCACTAAAATTACTTTAGTAGGAGAAATGTATTCT
TCCTGCAGAACA


Conceptual translation

MKLKITSNSASTLSAGSGIFMSSTLSEEHMEKNNVTEFILLGLTQNPEGQKILFVTFLLI
YIVTVMGNLLIMVTIIASQSLGSPMYFFLAYLSFIDTVYSTAIAPKMIIDLLYETKTISF
RACMTQVFIDHLFAGAEVILLVVMAYDRYVAICKPLHYLTVMNWRVCVLMLLGAWIGGLL
HSLIQFIFIYQLPFCGPNIIDNFLCDIYPLLKLACTNTYLIGLCMIANGGAICTVTFLIL
LVSYGVILHSLKAHSLEGKRKALYTCASHIAVVILFFVPCIFLFARPTSTFPIDKCVTVV
LTLITPMLNPLIYTLRNAEMKNAMRRLWTTKITLVGEMYSSCRT