Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a2 Olfactory Receptor

Gene Symbol Or4a2
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89417497-89418411 (-)
Aliases Olfr1239, RP24-427F7.6, MOR231-3, RP24-427F7.6, MOR231-3

Sequence information


Nucleotide sequence

ATGGAACAGAGAAACAATGTGACTGAGTTTGTCCTCTTGGGCCTGACTCAGAGTCCTGAA
GGCCAGAAAATATTATTTGTTGTGTTCTTGGTCATCTATGTTGTGACAATGGCAGGCAAT
CTACTCATTGTTGTGACTGTTGTGGTCAGCCCAAGTTTAGATGCCCCCATGTACTTCTTT
CTTGGCTACTTATCATTTATGGATGCTGTGTATTCAACCACAGTTACACCAAATATGATT
ATAGACTTACTCTATGAGAAGAAAACTATTTCCTTCAAAGCTTGCATGAGCCAGCTTTTC
ATAGGACACTTGTTTGGTGGAGCTGAGATCTTACTATTAGTTGTCATGGCCTATGACCGG
TATGTAGCCATCTGCAAACCCTTACATTATCTGACCATCATGAACCAACGTGTGTGTGTT
TTGCTCTTGTTATTGGCCTGGTTTGGGGGTTTCTTGCATGCTGTAGTCCAACTTCTATTT
GTATATAACCTTCCTTTCTGTGGTCCTAATATCATTGATCACTTCATCTGTGACATGTAT
CCCTTATTAAAATTGGCCTGCACAGACACCTATGTTATTGGCCTCACAGTTGTTGCCAAT
GATGGAGCAATATGTGTGGTCATCTTTATGCTGTTGGTCATTTCTTACGGGGTAATTCTT
CACTCCCTGAAGAATCTCAGTCAGGAAGGAAGGCGCAAAGCCTTATCCACCTGTGGCTCC
CATATCACTGTGGTAGTCCTCTTCTTTGTTCCCTGTATTTTTATGTATGTGAGACCTCCA
TCTACTTTACCCATTGATAAGTCATTGACTGTATTTTACACTGTTGTCACCCCCATGTTA
AATCCCCTCATATATACTCTGAGAAATGCAGAGATGAAAAATGCCATGAGGAAACTATGG
GCAAGTAAAGGGAAA


Conceptual translation

MEQRNNVTEFVLLGLTQSPEGQKILFVVFLVIYVVTMAGNLLIVVTVVVSPSLDAPMYFF
LGYLSFMDAVYSTTVTPNMIIDLLYEKKTISFKACMSQLFIGHLFGGAEILLLVVMAYDR
YVAICKPLHYLTIMNQRVCVLLLLLAWFGGFLHAVVQLLFVYNLPFCGPNIIDHFICDMY
PLLKLACTDTYVIGLTVVANDGAICVVIFMLLVISYGVILHSLKNLSQEGRRKALSTCGS
HITVVVLFFVPCIFMYVRPPSTLPIDKSLTVFYTVVTPMLNPLIYTLRNAEMKNAMRKLW
ASKGK