Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a2 Olfactory Receptor

Gene Symbol Or4a2
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78270961-78271875 (-)
Aliases Olr701, Olr701

Sequence information


Nucleotide sequence

ATGGAACAGAGAAACAATGTGACTGAGTTTGTTCTCTTGGGCCTTACTCAGAGTCCTGAA
GGCCAGAAAATATTATTTGTTGTGTTCTTGGTCATCTATGTTGTGACAATGGCAGGCAAC
CTACTCATTGTTGTGACTGTTGTGGTCAGTCCAAGTTTAGATGCCCCCATGTACTTCTTT
CTTGGCTACTTATCATTTATGGATGCTGTTTATTCAACTACAGTTACACCAAATATGATT
ATAGACTTACTCTATGAGAAGAAAACTATTTCCTTCAAAGCTTGCATGAGCCAGCTTTTC
ATAGGACACTTGTTTGGCGGAGCTGAGATCTTACTCTTAGTTGTCATGGCCTACGACCGG
TATGTAGCCATCTGTAAACCCTTACATTATCTGACTATCATGAACCAACGTGTGTGTGTG
TTGCTATTGTTGTTGGCCTGGTTTGGGGGTTTCTTGCACGCTGTAGTCAAACTCCTATTT
GTATATAACCTTCCTTTCTGTGGTCCTAATATCATTGATCACTTTATCTGTGACATGTAC
CCTTTATTAAAATTGGCCTGCACAGACACTTATGTTATTGGCCTCACAGTTGTTGCCAAT
GATGGGGCAATTTGTGTCATCATCTTTATACTGTTGGTGATTTCTTATGGGGTCATTCTT
CATTCCCTGAAGAATCTCAGTCAGGAAGGGAGGCGCAAAACCTTATCCACCTGTGGCTCC
CATATTACTGTGGTAGTCCTCTTCTTTGTTCCCTGTATTTTTATGTATGTGAGGCCTCCT
TCTACTTTACCCATTGATAAGTCATTGACTGTATTTTACACCATTATCACCCCAATGTTA
AATCCCCTTATATATACTCTGAGAAATGCAGAGATGAAAAATGCCATGAGGAAACTTTGG
ACAAGTAAAGGGAAA


Conceptual translation

MEQRNNVTEFVLLGLTQSPEGQKILFVVFLVIYVVTMAGNLLIVVTVVVSPSLDAPMYFF
LGYLSFMDAVYSTTVTPNMIIDLLYEKKTISFKACMSQLFIGHLFGGAEILLLVVMAYDR
YVAICKPLHYLTIMNQRVCVLLLLLAWFGGFLHAVVKLLFVYNLPFCGPNIIDHFICDMY
PLLKLACTDTYVIGLTVVANDGAICVIIFILLVISYGVILHSLKNLSQEGRRKTLSTCGS
HITVVVLFFVPCIFMYVRPPSTLPIDKSLTVFYTIITPMLNPLIYTLRNAEMKNAMRKLW
TSKGK