Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a39-ps Olfactory Receptor

Gene Symbol Or4a39-ps
Organism Rat
Family 4
Subfamily a
Pseudo Yes
Location chr3:78262830-78263982 (-)
Aliases Olr700-ps, Olr700-ps

Sequence information


Nucleotide sequence

ATGTGCTTAAGAAGAAAAGAAATTCATGGTCTTTTAATTATATCATTACAGATCCTGTTT
TCCTGAGTTATTCACTGAGAAGCAATCCAAATATACTTAAATGGGACAGAGAAACAATGT
CACAGAATTTATCCTCCTGGGACTCACTCAAGATCCAACTGGACAAAAAGCATTATTTGT
CATGTTTTTACTTATCTACATTGTGACAATGGTGGGCAATCTGCTTATTGTGGCCACAGT
GATTGCCAGCTCCTCCTTGGACTCCCCAATGTACTTCTTTCTTGCTTATTTATCAATCAT
GGTTTCTGTTTATTCTACTTCCACATCACCAAAGTTGATTATGGACTTACTCTCTGTCAA
AAAGACCATCTCTTTCACAGCTTGCATGGGACAACTCTTCATTGAGCACTTATTTGTTGG
TGCTGAGGACTTCCTCCTGGTGATGATGGCCTATGATCACTATGTGGCCATCTGTAAACC
CCTTCACTATTTGACCATCATGAATCGACAGATTTGCATCCTTCTGTTGGTAATAGCCTG
GGTTGGTGTGTTTGCTCACTCTGTGATTCAACTTGCTTTTGTGTCTAATTTGCCTTTCTG
TGGACCCAATGTCATCGACCATTTTATCTGTGACATGTACCCACTATTGTGACTTGCATG
CAGTGACACTTACTTCATTGGCCTTACTGTGGTTGTGAATGGTGGAGCAATCTGTATGGT
CATTTTTATTCTTCTTTTAATCTCCTATGCATTCATCCTAAACTCTCTTAAAAACTACAG
TCAGGAAGGGAGATGTAAAGCCTTGTCCACCTGCAGCTCCCACATCACTGTGGTTGTTCT
TTTTTTTTTTTGGTCCCCTGCATTTTCATTTATGTTAGGCCAGTGTCTAACTTTCCCATT
GATAAGTCAATAAGTGTGGTTTTTACAGTTATCACTCCCATGCTGAACCCTTTAATATAT
ACTCTGAGAAATGCAGAGATGAAAAATGCCATGCAAAAACTCTGGTGTAAAACATCAACT
ACAGGCAGAGTAAGAGTGCACTCCACACACTGAGGACTTCTGTTGTAGTGAAGGACCCTA
GGGGATTTTGACAGCCTTACACCACCTGACTCAGGTCAAGACTAAGCCAAGTTCCATTCT
CCACCCACAGTTC


Conceptual translation

MGQRNNVTEFILLGLTQDPTGQKALFVMFLLIYIVTMVGNLLIVATVIASSSLDSPMYFF
LAYLSIMVSVYSTSTSPKLIMDLLSVKKTISFTACMGQLFIEHLFVGAEDFLLVMMAYDH
YVAICKPLHYLTIMNRQICILLLVIAWVGVFAHSVIQLAFVSNLPFCGPNVIDHFICDMY
PLL*LACSDTYFIGLTVVVNGGAICMVIFILLLISYAFILNSLKNYSQEGRCKALSTCSS
HITVVVLFF/LVPCIFIYVRPVSNFPIDKSISVVFTVITPMLNPLIYTLRNAEMKNAMQ
KLWCKTSTTGRVRVHS