Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a47 Olfactory Receptor

Gene Symbol Or4a47
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78716475-78717401 (-)
Aliases Olr720, Olr720

Sequence information


Nucleotide sequence

ATGGAACCAAAGAACAATGTAACCTACTTTGTCCTCTTGGGCCTCTCACAGAATCCAAAG
GTGCAGAAAGGACTCTTTGTTCTTTTCTTGCTTTCCTATATTCTGACCATGGTGGGAAAT
ATGCTCATTGTTATGACTGTAACCATCAGTAACAGCTTGGGCTCACCAATGTATTTCTTT
CTTGCTAGCTTGTCATTTGTGGATATCATTTATTCATCCGCCATTTCTCCCAAATTGATT
TCAGATTTGTTCTTCAGCCAAAACACAATATCCTTTAAATTTTGTATGACTCAGCTCTTC
ACAGAACACTTTTTTGGTGGTTCAGAGGTTTTTCTTCTGTTGGTGATGGCCTATGATCGT
TACGTGGCCATCTGTAAGCCCTTGCATTATTCAACTATCATGAAGCAATGGGTTTGTGTT
GTGCTGTTGATATTATCTTGGATTGGAGGATTTTTGCACTCAGTGATTCAGCTCAGCACT
ATATATGGACTACCATTCTGTGGTCCTAATGTCATTGATCATTTTATGTGTGACATGTAC
CCCTTACTAAAACTTGTTTGTATTGACACCTATGCCATTGGCCTCTTAGTGATGGCCAAT
GGAGGGCTGATCTGCACGGTTGTGTTTCTACTCTTACTCATCTCTTATGGTGTCATCTTG
TACTCTCTAAAGAGCCTTAATCAGGAAGGGAGGTGGAAAGCTCTCTCTACCTGTGGCTCC
CACATCACTGTAGTTGTTTCATTCTTTGTTCCCTGTATTTTCATGTATGCACGACCTGCT
AAAACTTTCCCCATTGACAAATTGTTGAGTGTGTTTTATACAGTCATTACCCCCATGATG
AACCCCTTGATATATACTCTGAGAAACTCAGAGATGACAAATGCTATGAAGAAGCTGTGG
AGAAGAAAAGTTATTTCAGGACACAAA


Conceptual translation

MEPKNNVTYFVLLGLSQNPKVQKGLFVLFLLSYILTMVGNMLIVMTVTISNSLGSPMYFF
LASLSFVDIIYSSAISPKLISDLFFSQNTISFKFCMTQLFTEHFFGGSEVFLLLVMAYDR
YVAICKPLHYSTIMKQWVCVVLLILSWIGGFLHSVIQLSTIYGLPFCGPNVIDHFMCDMY
PLLKLVCIDTYAIGLLVMANGGLICTVVFLLLLISYGVILYSLKSLNQEGRWKALSTCGS
HITVVVSFFVPCIFMYARPAKTFPIDKLLSVFYTVITPMMNPLIYTLRNSEMTNAMKKLW
RRKVISGHK