Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a66 Olfactory Receptor

Gene Symbol Or4a66
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:88700386-88701348 (-)
Aliases Olfr1196, RP23-316D8.8, MOR225-5, RP23-316D8.8, MOR225-5

Sequence information


Nucleotide sequence

ATGTGGATTCACCTAGAATTCATGGAAAATCATAAAAATGTCACAGAGTTCATTTTCATG
GGTCTTTGGCAGAATAGACAAATAGAGCTGCTGTTCTTTCTCTTGTTCCTGCTTTGCTAT
CTGGCTATCTTAATGGGGAACTCTGTCATCCTATTCACCATCACCTGCAGCCACCTAATA
GAACAACCAATGTATTATTTTCTCTGCCATCTTTCCCTCATGGACCTCTGCTACACCTCT
ACTGTGATTCCCAGGCTCATCAGAGACTTGGCCACAACAAGAAAAAACATTTCCTATAAT
GAGTGCATGACCCAGCTCTTCACTTCCCACTTGCTGGCAGGTGTGGAAATCTTCATCCTG
GTGTCCATGGCCTTGGACCGCTATGTTGCCATTGTCAAGCCCCTGCACTACATGGTTATC
ATGAGCAGGAAGAGATGTGATATGTTGATTGTCACGGCCTGGATACTGGGGTTCTGGCAC
TCCATTGCTTTACTACTGATGGTGCTCAGTCTGCCATTCTGTGGTCCCAACCACATCAAT
CACTACTTGTGTGACATCAAGCCTCTTCTGAAATTGGTCTGTAAAGACGTTCATGTTGTA
AGTATCTTAGCAATTGCCAACTCTGGGATGGTGCTTTTTGCTATTTTTATTGTACTACTT
GCCTCTTACATACTCATATTGTATTCTCTGAGGACAAGATCATCTGCAGGGAAGCGCAAA
GCACTCTCTACCTGTAGTTCACACATAATGGTAGTAGTTTTATTTTTTGGGCCCTGTATT
TATATCTATATTTTACCCGCAGGAAGTGAGAACAAGGATAAGGAAATTTCTGTGTTTTAC
ACTGTGATTGCCCCAATGTTGAATCCCCTTATCTATACTCTGAGAAACAGTGAGATGAAA
AGTGCCATGCACAAGGTGTGGTCTCGGCTGTCACTCAGAGTTGAAGTAAGTGAAAGAATA
TTG


Conceptual translation

MWIHLEFMENHKNVTEFIFMGLWQNRQIELLFFLLFLLCYLAILMGNSVILFTITCSHLI
EQPMYYFLCHLSLMDLCYTSTVIPRLIRDLATTRKNISYNECMTQLFTSHLLAGVEIFIL
VSMALDRYVAIVKPLHYMVIMSRKRCDMLIVTAWILGFWHSIALLLMVLSLPFCGPNHIN
HYLCDIKPLLKLVCKDVHVVSILAIANSGMVLFAIFIVLLASYILILYSLRTRSSAGKRK
ALSTCSSHIMVVVLFFGPCIYIYILPAGSENKDKEISVFYTVIAPMLNPLIYTLRNSEMK
SAMHKVWSRLSLRVEVSERIL