Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a66 Olfactory Receptor

Gene Symbol Or4a66
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:77,169,200-77,170,100 (-)
Aliases Olr654

Sequence information


Conceptual translation

MWIHLEFMENHKNVTEFIFMGLWENRQIELLFFVLFLLCYLAVLMGNSVILVTITCSHLI
EQPMYYFLCHLSLMDLCYTSTVIPRLIRDLAATRKNISYNECMTQLFTGHLLAGVEIFIL
VSMALDRYVAIVKPLHYMVIMRRKRCDMLIVTAWIVGFWHSIALLLMVLSLPFCGPNHIN
HYLCDVKPLLNLVCEDVHVVSILSIANSGMVVVAIFIVLLASYILILYSLRTRSSAGQRK
ALSTCSSHIMVVVLFFGPCIYIYILPAGNENKDKEISLFYTVIAPILNPLIYTLRNSEMK
NAMHKVWSQMSNSHLK