Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a66b Olfactory Receptor

Gene Symbol Or4a66b
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:77401650-77402579 (-)
Aliases Olr658, Olr658

Sequence information


Nucleotide sequence

ATGGAAAATCATAAAAATGTCACAGAGTTCATTTTTATGGGTCTTTGGGAGAATAGACAA
ATAGAGCTGCTGTTCTTTCTCTTGTTCCTGCTTTGCTACCTGGCTGTCTTAATGGGGAAC
TCTGTTATCCTAGTCACCATCACCTGCAGCCATTTAATCGAACAACCAATGTACTACTTT
CTCTGCCACCTTTCCCTCATGGACCTCTGCTACACCTCCACTGTGATTCCCAGGCTCATC
AGGGACTTGGCCGCAACTAGAAAAAACATTTCCTATAATGAGTGCATGACCCAGCTCTTC
ACTGCCCACTTGCTGGCAGGTGTGGAAATCTTCATCCTGGTATCCATGGCCTTGGACCGC
TATGTTGCCATTGTCAAGCCCCTGCACTACATGGTTATCATGCGCAGGAAGAGATGTGAT
ATGTTGATTGTCACGGCCTGGATAGTGGGGTTCTGGCACTCCATTGCTTTACTACTCATG
GTGCTCAGCCTTCCATTCTGTGGTCCCAACCACATCAATCACTATTTCTGTGATGTCAAG
CCTCTTTTGAAGCTGGTCTGTAAAGATGTTCATGTCGTTAGTGTCTTAGCAATGGCTAAC
TCTGGGATGGTGCTTGTTGCCATTTTTACTGTACTACTTGCTTCTTACATACTCATATTG
TATTCTCTGAGAACAAGATCATCTGCAGGGCTACTCAAAGCACTTTCAACCTGTAGTTCA
CACATAATGGTGGTAGTTTTATTTTTTGGACCCTGTATTTATACCTATGCTTTACCTGCT
GGAAGTGAGAACAAGGATAAGGAGATTTCTGTGTTTTACACTGTGCTTGCCCCCATGTTG
AATCCCCTCATCTACACACTGAGAAACAGTGAGATGAAAAGTGCCATGCACAAGGTGTGG
TCTTGGCTGTCAAATTCAGAATTGAAGTAA


Conceptual translation

MVLMGHQHFHLLPACDSMVRTSLATNTFQLRWILFTKPHFSFPSFIPSLVIPLTFPPLFL
PILISLPFFICNFRRTKFQLCMLIDLKFMENHKNVTEFIFMGLWENRQIELLFFLLFLLC
YLAVLMGNSVILVTITCSHLIEQPMYYFLCHLSLMDLCYTSTVIPRLIRDLAATRKNISY
NECMTQLFTAHLLAGVEIFILVSMALDRYVAIVKPLHYMVIMRRKRCDMLIVTAWIVGFW
HSIALLLMVLSLPFCGPNHINHYFCDVKPLLKLVCKDVHVVSVLAMANSGMVLVAIFTVL
LASYILILYSLRTRSSAGLLKALSTCSSHIMVVVLFFGPCIYTYALPAGSENKDKEISVF
YTVLAPMLNPLIYTLRNSEMKSAMHKVWSWLSNSELK