Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a68 Olfactory Receptor

Gene Symbol Or4a68
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89439336-89440277 (-)
Aliases Olfr1240, RP24-427F7.7, MOR231-8, RP24-427F7.7, MOR231-8

Sequence information


Nucleotide sequence

ATGGGAAAGAGCAACAATGTGACAGAGTTTATCCTGCTGGGTCTTACACAGGATCCTGCT
GGGAGAAAGGCATTGTTTGTCATGTTTTTACTCATTTACATTGTGACCATGGTGGGAAAC
CTACTCATTGTGGAGACAGTGATTTCCAGCCCCTCCTTGGACTCCCCAATGTACTTCTTC
CTTGCCTCTCTGTCTCTCATGGATGCTGTTTACTCGACTGCCTTCTCACCCAAGTTGATT
ATGGACTTACTCTGCAATAGAAGAACAATTTCCGTTTCAGCTTGCATTGGCCAGCTCTTT
GTAGAGCACTTATTTGGTGGTGCTGAGGTCTTCCTTTTGGTCTTCATGGCCTACGATCGC
TATGTGGCTATCTGTAAACCCCTGCATTATATGACCATCATGAATCGTCAGGTTTGCATT
CTCCTATTGGTGGCAGCCTGTGCTGGAGGTTTTGGTCACTCTTTGGTTCAAGTCATCGTT
GTTTGCTACCTCCCTTTTTGTGGTCCAAATACCATTGATCACTTTATCTGTGACATGTAC
CCATTACTGGGCTTAGCATGTACTGACACTTACTTAATTGGGCTCACTGTGGTTGCCAAT
GGTGGAGCAATTTGTATGACGGTCTTTATCCTCCTCCTTGTCTCCTATGGAATCATTCTA
AACTCTCTTAAGTCTCATAGTGAGGAAGGGAGGCGCAAAGCCCTGTCCACCTGCAGCTCC
CACATCATAGTGGTTGTCCTCTTTTTTGTTCCCTGTATTTTCATGTATGTTAGACCTGTC
TCCAACTTTCCTATTGATAAATCCCTAACTGTAGTTTATACAGTTATCACCCCCATGTTG
AATCCTTTAATATATACTCTGAGAAATGCGGAGATGAAAAACAGTATGAAAAAACTTTGG
TGTGAAAGATTAACTATGGAAAGATTGAGAATGTTCCCTCAC


Conceptual translation

MGKSNNVTEFILLGLTQDPAGRKALFVMFLLIYIVTMVGNLLIVETVISSPSLDSPMYFF
LASLSLMDAVYSTAFSPKLIMDLLCNRRTISVSACIGQLFVEHLFGGAEVFLLVFMAYDR
YVAICKPLHYMTIMNRQVCILLLVAACAGGFGHSLVQVIVVCYLPFCGPNTIDHFICDMY
PLLGLACTDTYLIGLTVVANGGAICMTVFILLLVSYGIILNSLKSHSEEGRRKALSTCSS
HIIVVVLFFVPCIFMYVRPVSNFPIDKSLTVVYTVITPMLNPLIYTLRNAEMKNSMKKLW
CERLTMERLRMFPH