Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a69 Olfactory Receptor

Gene Symbol Or4a69
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89482192-89483133 (-)
Aliases Olfr1241, RP23-150I5.1, MOR231-14

Sequence information


Nucleotide sequence

ATGGGACAGAGAAGCAATGTCACAGAGTTCATTCTCCTGGGCCTCACTCAAGATCATGTT
GGACAAAGAGCATTGTTTGTCATGTTTTTACTCATCTACATTGTGACTATAGTAGGTAAT
CTACTCATTGTGGGGACAGTCATAGCCAGTCCCTCCTTAGGGACTCCAATGTACTTCTTC
CTTGCCTATCTGTCACTTCTGGATGCTGTTTATTCCACTGCTATCTCACCCAAGTTGATG
GTAGACTTGCTCTGTGATAGAAAAACAATTTCCTTTTCAGCTTGCATGACTCAGCTCTTT
TTAGAGCACCTACTTGGTGGTGCTGAGGTCTTCCTTCTAATGGTGATGGCCTATGATCGT
TATGTGGCCATCTGTAAACCACTGCATTATTTGATCATCATGAATAGGCGGGTTTGCTTC
CTCCTATTGGTGGTTTCCTGGGCTGGAGGCCTTGCACACTCTGTAGCTCAACTTCTCTTT
GTATATAATCTTCCATTTTGTGGTCCAAATGTAATTGACCACTTTATCTGTGACATGTAC
CCATTATTAGGACTTGCATGCACAGATACACATATTATTGGCCTCACTGTGGTTGCCAAT
GGTGGAGCAATATGTATGTTAGTCTTTATTATTCTCATAATTTCCTATGGAATCATTCTA
AGATCTCTTAAGACTCACAGTCAGGAAGGGAGACAGAAAGCCTTATCTACCTGCAGCTCC
CACATCATGGTGGTTGTCCTCTTTTTTGTTCCCTGTATCTTCATGTATGTTAGACCTGTT
CACAACTTTCCTATTGATAAATCCATTACTGTTTTTTATACAATTGTTACTCCTATTTTG
AATCCTTTAATATATGCCTTGAGAAACTCAGAGATGAAAAGGTCTATGGAAAATCTATTA
TATAAGGTATTCCCTAGAGATAAAATAACAATGTCTTTTCAT


Conceptual translation

MGQRSNVTEFILLGLTQDHVGQRALFVMFLLIYIVTIVGNLLIVGTVIASPSLGTPMYFF
LAYLSLLDAVYSTAISPKLMVDLLCDRKTISFSACMTQLFLEHLLGGAEVFLLMVMAYDR
YVAICKPLHYLIIMNRRVCFLLLVVSWAGGLAHSVAQLLFVYNLPFCGPNVIDHFICDMY
PLLGLACTDTHIIGLTVVANGGAICMLVFIILIISYGIILRSLKTHSQEGRQKALSTCSS
HIMVVVLFFVPCIFMYVRPVHNFPIDKSITVFYTIVTPILNPLIYALRNSEMKRSMENLL
YKVFPRDKITMSFH