Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a69 Olfactory Receptor

Gene Symbol Or4a69
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78,408,300-78,409,300 (-)
Aliases Olr704

Sequence information


Nucleotide sequence

ATGGGACAGAGAAGTAATGTCACAGAGTTTGTTCTCCTGGGTCTCACTCAAGATCCTGCT
GGGCAAAAAGCATTGTTTGTCATGTTTTTACTCATCTACATTGTGACTATAGTAGGTAAC
CTGCTCATTGTGGGGACAGTCATAGCCAGTCCCTCCTTAGGGACTCCAATGTATTTCTTC
CTTGCCTATCTGTCACTTCTGGATGCTGTTTATTCCACTTCTATTTCACCCAAGTTGATG
ATAGACTTGCTCTGTAATAGAAAAACAATTTCCTTTTCGGCTTGTATGACTCAGCTCTTC
TTAGAGCATCTACTTGGTGGTGCTGAGGTCTTCCTTCTTATGGTGATGGCCTATGATCGT
TATGTGGCCATCTGTAAACCACTGCATTATTTGATTATCATGAATAGGAGGGCTTGCTTC
CTCCTATTGGTGGTTTCCTGGGCTGGAGGCCTTACCCACTCTGTAGCTCAACTTCTCTTT
GTATATAACCTTCCCTTTTGTGGTCCAAATGTTATTGACCACTTCATCTGTGACATGTAC
CCATTATTAGGACTTGCATGCACTGATACATATTTTATTGGCCTCACTGTGGTTGCCAAT
GGTGGAGCAATATGTATGTTAGTCTTTATCATTCTCATAATTTCCTATGGAATCATTCTA
AAATCTCTTAAGACTCACAGTCAGGAAGGGAGACAGAAAGCCTTATCCACTTGCAGCTCC
CACATCATGGTGGTTGGCCTTTTCTTTGTTCCCTGTATTTTCATGTATGTTAGACCTGTT
CACAACTTTCCAATTGATAAATCCATTACTGTTTTTTATACAATTGTCACTCCTATTTTG
AATCCTTTAATATATGCCTTGAGAAATTCAGAGATGAAAAAGTCTATGGAAAATCTAATG
TATAAGGTTTTTCGTAGAGTT


Conceptual translation

MGQRSNVTEFVLLGLTQDPAGQKALFVMFLLIYIVTIVGNLLIVGTVIASPSLGTPMYFF
LAYLSLLDAVYSTSISPKLMIDLLCNRKTISFSACMTQLFLEHLLGGAEVFLLMVMAYDR
YVAICKPLHYLIIMNRRACFLLLVVSWAGGLTHSVAQLLFVYNLPFCGPNVIDHFICDMY
PLLGLACTDTYFIGLTVVANGGAICMLVFIILIISYGIILKSLKTHSQEGRQKALSTCSS
HIMVVGLFFVPCIFMYVRPVHNFPIDKSITVFYTIVTPILNPLIYALRNSEMKKSMENLM
YKVFRRV