Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a70 Olfactory Receptor

Gene Symbol Or4a70
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89493393-89494310 (-)
Aliases Olfr1242, RP23-150I5.2, MOR231-5, RP23-150I5.2, MOR231-5

Sequence information


Nucleotide sequence

ATGGGACAGAACCACAATGTCACAGAATTCATTTTTGTGGGTCTTAGTCAAGATCCTGCT
GGGCAAAAAGTATTATTTGTCTTGTTTTCACTGACTTACATTGTGACAATGTTCGGAAAC
CTGCTCATTGCACTTACAGTGATTGCCAGCCCCTCCTTAAACTCCCCAATGTACTTCTTC
CTTGCCTGTCTGTCAGTCCTGGATGCTCTTTATTGCAATACAATCTCACCAAATTTGATT
ATAGACTTGTTATATAATAAAAAGAATATCTCCTTCAGAGCTTGCATGCTCCAGCTGTTT
GTAGAGCACTTATTTGGAGGTGTTGAGGTCTTCCTTCTGGTATTCATGGCCTATGATCGC
TATGTGGCCATCTGTAAGCCACTGCACTATTTGACCATCATGAACCAGAGGGTGTGCATT
CTTCTATTGCTGATAGCTGGAGTTGGAGGCATCTTACACTCACTGATTCAAGTTCTGACT
GTGTATAAACTTCCTTTTTGTGGTCCCAATGTCATTGATCACTTCATGTGTGACATGAAT
CAATTACTCGGGCTTGCATGCACTGACACCTACTTCCTTGGCATCACTGTCATGGCCAAT
GGTGGAGTAATCTGTGTGGGAATTTTCACCTTTCTCTTAGTCTCCTATGGAATCATTCTA
AACTCTCTTAAGACCCACAGTCGGGAAGGAAGACATAAAGCTCTGTTTACCTGCAGTTCT
CACATCATGGTTGTTGTCTGCTTTTTTGCTCCCTGTAGTTTTATATATGCTAGACCTGTC
TCCAACTTTCCAGTGGATAAATATATTGCTGTGTTTTATACAGTTGTTAGTCCCATGCTG
AATCCATTGATATATACCTTGAGAAATTCAGAGATGAAAAACTCTATTAAAAAGCTCTGG
TGTAAAACTCTAACAACA


Conceptual translation

MGQNHNVTEFIFVGLSQDPAGQKVLFVLFSLTYIVTMFGNLLIALTVIASPSLNSPMYFF
LACLSVLDALYCNTISPNLIIDLLYNKKNISFRACMLQLFVEHLFGGVEVFLLVFMAYDR
YVAICKPLHYLTIMNQRVCILLLLIAGVGGILHSLIQVLTVYKLPFCGPNVIDHFMCDMN
QLLGLACTDTYFLGITVMANGGVICVGIFTFLLVSYGIILNSLKTHSREGRHKALFTCSS
HIMVVVCFFAPCSFIYARPVSNFPVDKYIAVFYTVVSPMLNPLIYTLRNSEMKNSIKKLW
CKTLTT