Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a70 Olfactory Receptor

Gene Symbol Or4a70
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78428666-78429583 (-)
Aliases Olr705, Olr705

Sequence information


Nucleotide sequence

ATGGGACAGGGCTACAATGTCACAGAATTCATTTTTGTGGGCCTTACTCAAGATCCTGCT
GGACAAAAAGCATTATTTGCCTTGTTTTCACTCACCTACATTGTGACAATGCTGGGCAAC
TTGCTCATTGCAGGGACAGTGATTGCCAGCCCTTCCTTAAAATCCCCAATGTACTTCTTT
CTTGCCTGTCTGTCAGTCCTGGATGCTCTTTATTGCAATTCCATCTCACCAAATTTGATT
ATAGACTTATTATATAATAAAAAGACTATTTCTTTCAAATCATGCATGCTCCAGCTCTTC
GTAGAGCACTTATTTGGCGGTGTTGAGGTCTTCCTTCTGGTTTTCATGGCCTATGATCGC
TATGTGGCCATCTGCAAGCCACTGCACTATTTGACCATTATGAACCAGCGGGTGTGCATT
CTCCTTTTGCTGGTCGCTGGTGTTGGAGGCACAGTACACTCAACGATTCAAGTTCTGACT
GTGTATAAACTCCCTTTTTGTGGTCCCAATGTCATTGATCACTTCATGTGTGACATGAAT
CCACTACTGGGACTTGCGTGCACTGACACCTACTTCCTTGGCATCACCGTCATGGCCAAT
GGTGGAGTAATCTGTGTGGGAATTTTCACCTTTCTCTTAGTCTCCTATGGAATCATTCTA
AACTCTCTTAAGACCCACAGTCAGGAAGGAAGGCGCAAAGCTCTGTTCACCTGCAGCTCC
CATATCACGGTGGTTGTGTGTTTTTTTGCTCCCTGCAGTTTTATATATGCTAGGCCTGTC
TCCAACGTTCCTATTGATAAATATATCGCTGTGTTTTATACAGTTGTTAGCCCCATGTTG
AATCCATTGATATATACCTTGAGAAATTCAGAGATGAAAAATTGTATAAAAAAGCTCTGG
TCTAAAACTTTAACAAAA


Conceptual translation

MGQGYNVTEFIFVGLTQDPAGQKALFALFSLTYIVTMLGNLLIAGTVIASPSLKSPMYFF
LACLSVLDALYCNSISPNLIIDLLYNKKTISFKSCMLQLFVEHLFGGVEVFLLVFMAYDR
YVAICKPLHYLTIMNQRVCILLLLVAGVGGTVHSTIQVLTVYKLPFCGPNVIDHFMCDMN
PLLGLACTDTYFLGITVMANGGVICVGIFTFLLVSYGIILNSLKTHSQEGRRKALFTCSS
HITVVVCFFAPCSFIYARPVSNVPIDKYIAVFYTVVSPMLNPLIYTLRNSEMKNCIKKLW
SKTLTK