Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a71 Olfactory Receptor

Gene Symbol Or4a71
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89527494-89528408 (-)
Aliases Olfr1243, RP23-150I5.3, MOR231-4, RP23-150I5.3, MOR231-4

Sequence information


Nucleotide sequence

ATGGGACAGAGCTACAATGTCACAGAATTCATTTTTGTGGACCTTACTCAAGATCCTGCT
GGGAAAAAAGCCTTATTTGTCTTGTTTTCACTTACCTACATTGTGACAATGCTGGGTAAC
CTGCTCATTGCAGTGACGGTGATTGCCAGCCCTTCCTTAAACTCCCCAATGTACTTCTTT
CTTGCCTGTCTGTCAGTCCTGGATGCTTTTTATTGCAATACTATCTCACCCAATTTGATT
ATAGGTTTATTAAAAGATAAAAATAATATCTCCTTCAGAGCTTGCATGCTCCAGCTCTTT
GTAGAGCACTTATTTGGAGGTGTTGAGGTCTTCCTTCTGGTATTCATGGCCTATGATCGC
TATGTGGCCATCTGTAAGCCACTGCACTATTTGACCATCATGAATCAGCGGGTGTGCATT
CTTCTGTTGCTGGTAGCTGGAGTTGGAGGCATCTTACACTCATTGATTCAAGTTCTCACT
GTGTATAAACTTCCTTTTTGTGGTCCCAATGTCATTGATCACTTCATGTGTGATATGAAT
CCATTACTGGGACTTGCATGCACTGACACCTACTTCCTTGGCATCACTGTCATTGCCAAT
GGTGGAGTAATCTGTGTGGGAATTTTCACCTTTCTCTTAGTCTCCTATGGAATCATTCTA
AACTCTCTTAAGACCCACAGCCAGGAAGGAAGGCGCAAAGCTCTGTCCACCTGTAGTTCC
CACATCATGGTGGTTGTCTGCTTTTTTGCTCCCTGTATTTTTATATATGCTAGGCCTGTT
TCCAATTTTTCCATTGATAAATATATTGCTGTGTTTTATACGGTTGTTAGTCCTATGCTT
AATCCATTGATATATACCTTGAGAAATTCAGAGATGAAAAATTCTATAAAAAAGCTCTGG
TGTAAAACACTAGCA


Conceptual translation

MGQSYNVTEFIFVDLTQDPAGKKALFVLFSLTYIVTMLGNLLIAVTVIASPSLNSPMYFF
LACLSVLDAFYCNTISPNLIIGLLKDKNNISFRACMLQLFVEHLFGGVEVFLLVFMAYDR
YVAICKPLHYLTIMNQRVCILLLLVAGVGGILHSLIQVLTVYKLPFCGPNVIDHFMCDMN
PLLGLACTDTYFLGITVIANGGVICVGIFTFLLVSYGIILNSLKTHSQEGRRKALSTCSS
HIMVVVCFFAPCIFIYARPVSNFSIDKYIAVFYTVVSPMLNPLIYTLRNSEMKNSIKKLW
CKTLA