Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a71 Olfactory Receptor

Gene Symbol Or4a71
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:77,985,000-77,985,900 (+)
Aliases Olr684

Sequence information


Nucleotide sequence

ATGGGACAGGGCTACAATGTCACAGAATTCATTTTTGTGGGCCTTACTCAAGATCCTGCT
GGACAAAAAGCATTATTTGCCTTGTTTTCGCTCACCTATCTTGTGACAATGCTGGGCAAC
TTGCTCATTGCAGTGACAGTGATTGCCAGCCCTTCCTTAAAATCCCCAATGTACTTCTTT
CTTGCCTGTCTGTCAGTCCTGGATGCGTTTTATTGCAATACCATCTCACCAAATTTGATT
GTAGGCTTTTTAAAAGATAAAAAGACAATCTCCTTCAGAGCTTGCATGCTCCAGCTCTTC
GTAGAGCACTTATTTGGCGGTGTTGAGGTCTTCCTTCTGGTTTTCATGGCCTATGATCGC
TATGTGGCCATCTGCAAGCCACTGCACTATTTGACCATTATGAACCAGCGGGTATGCATT
CTCCTTTTGCTGGTCGCTGGTGTTGGAGGCACAGTACACTCAACGATTCAAGTTCTGACT
GTGTATAAACTCCCTTTTTGTGGTCCCAATGTCATTGATCACTTCATGTGTGACATGAAT
CCACTACTGGGACTTGCGTGCACTGACACCTTCTTCCTTGGCATCACCGTCATGGCCAAT
GGTGGAGTAATCTGTGTGGGAATTTTCACCTTTCTCTTAGTCTCCTATGGAATCATTCTA
AACTCTCTTAAGACCCACAGTCAGGAAGGAAGGCGCAAAGCTCTGTCCACCTGCAGCTCC
CACATCATGGTGGTTATTTGCTTTTTTGCTCCCTGTATTTTTATTTATGCTAGACCTGTC
TCCAACTTTCCTATTGATAAATATATCGCTGTGTTTTATACAGTTGTTAGTCCTATGCTG
AATCCATTGATATATACCTTGAGAAACTCAGAAATGAAAAATTCCATAAAAAAGCTCTGG
TGTAAAACATCAGCA


Conceptual translation

MGQGYNVTEFIFVGLTQDPAGQKALFALFSLTYLVTMLGNLLIAVTVIASPSLKSPMYFF
LACLSVLDAFYCNTISPNLIVGFLKDKKTISFRACMLQLFVEHLFGGVEVFLLVFMAYDR
YVAICKPLHYLTIMNQRVCILLLLVAGVGGTVHSTIQVLTVYKLPFCGPNVIDHFMCDMN
PLLGLACTDTFFLGITVMANGGVICVGIFTFLLVSYGIILNSLKTHSQEGRRKALSTCSS
HIMVVICFFAPCIFIYARPVSNFPIDKYIAVFYTVVSPMLNPLIYTLRNSEMKNSIKKLW
CKTSA