Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a72-ps Olfactory Receptor

Gene Symbol Or4a72-ps
Organism Rat
Family 4
Subfamily a
Pseudo Yes
Location chr3:78493143-78494067 (-)
Aliases Olr707, Olr707

Sequence information


Nucleotide sequence

ATGGGAGAGAACAATAATATCACAGAATTTATTCTGCTGGGTCTCACACAGGATCCTGAT
GGGAGAAAAGCATTGTTTGTCATCTTTTTCCTCATCTACATTGTGACAATGATGGGCAAC
CTGCTCATTGTGGTGACAGTCATTGCCAGCCCCTCCCTGGGCTCCCCAATGTACTTCTTC
CTTGCCTCTCTATCACTCTTGGATGCTCTTTTCTCCACTGCCATCTCACCCAAGTTGATT
GCAGACTTACTCTATGATCAAAAGACCATCTCCTTTAGAGCCTGCATGAGCCAGCTCTTT
ATAGAGCATTTATTTGGTGGTGTTGATATTGTTATTCTGGTGGCAATGGCCTATGATCGT
TATGTGGCCATCTGTAAGCCACTGCACTACTTGGCCATCATGAATCGAAGGGTTTGCATC
ACTTTGTTGATATTTGCCTGGACTGGAGGTTTTACACACTCTCTGATTCAAATTGTCTTT
GTTTACAACCTTCCTTTTTGTGGCCCTAATGTCATTGATCATTTCATTTGTGACATGTCT
CCATTATTGGTACTTGCATGCACAGATACCTACTTCATAGGCCTCACTGTTATTGCTAAT
GGCGGAGTCATGTGTATTGTGATCTTCACCCTCCTCCTAGGCTCCTATGGAATCATCCTA
AGATCTCTTAAGACTCAAAGTCAGGAAGGGAGGCGCAAAGCCCTGTCCACATGCAGCTCC
CACATCCTGGGTTGTCATCCTCTTTTTCGTTCCATGTATTTTTATGTATGCCAGACCAGT
TTACAACTTTCCTATCGATAAATGTATTACTGTTTTTTATACAATTATCACTCCCATGTT
GAATCCTTTAATATATACCTTAAGAAATTCAGAGATAAAAAGTTGTATGAAAAAGCTCTG
GTGTAAAATGCTACATGCTGATTAA


Conceptual translation

MGENNNITEFILLGLTQDPDGRKALFVIFFLIYIVTMMGNLLIVVTVIASPSLGSPMYFF
LASLSLLDALFSTAISPKLIADLLYDQKTISFRACMSQLFIEHLFGGVDIVILVAMAYDR
YVAICKPLHYLAIMNRRVCITLLIFAWTGGFTHSLIQIVFVYNLPFCGPNVIDHFICDMS
PLLVLACTDTYFIGLTVIANGGVMCIVIFTLLLGSYGIILRSLKTQSQEGRRKALSTCSS
HIL\VILFFVPCIFMYARPVYNFPIDKCITVFYTIITPMLNPLIYTLRNSEIKSCMKKL
WCKMLHAD