Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a73 Olfactory Receptor

Gene Symbol Or4a73
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89590172-89591113 (-)
Aliases Olfr1246, RP23-150I5.5, MOR231-9, RP23-150I5.5, MOR231-9

Sequence information


Nucleotide sequence

ATGGGAGAAAGAAACAATGTCACAGAATTTGTCCTTTTGGGGCTCACTCAGGATCCTGCA
GGTCAAAAAGTATTATTTGTCATGTTTTTGCTCATCTACATTGTGACAATGGTTGGCAAC
CTGCTCATTGTGCTGATGGTGATTGCCAGCCCCTCTTTGGGCTCCCCAATGTACTTCTTC
CTTGCCTGTCTTTCATTCCTGGACATTGTTTATTCAACTTCCATCTCACCAAAGTTGATT
ATGGACTTGCTGTGTGATGAAAAGTCTATCTCCTTCACAGCTTGCATGAGCCAGCTCTTT
ATAGAGCATTTATTTGGAGGCACTGAGATTGTCATTCTGGTGGCAATGGCCTATGATCGC
TATGTGGCAATCTGTAAACCACTGCACTATTTGACCATCATGAATCGAAAGGTTTGTATA
ATTTTGTTGGGATTTTCCTGGGTTGGAGGTTTTACACACTCCATGATTCAAATTCTCTTT
GTTTTCAACCTTCCTTTCTGTGGTCCAAATATTATTGACCACTTTATGTGTGACATGTCC
CCATTATTGGGACTTGTGTGCACTGACACCTACTTCATTGGTCTTACCCTCATTGCCAAT
GGTGGAGCCATGTGCATTGTAGTCTTTATCCTTCTCATAGTGTCTTATGGAATCATCCTT
AAATCTCTCAAGAATTATAGTCAGGAAGGGAGGCGCAAAGCCCTGTCTACTTGCAGCTCC
CACATCATGGTAGTTACACTTTTTTTTGTTCCCTGCATTTTCATGTATGCCAGACCTGTT
TATAACTTTTCTAGTGACAAATACATTACTGTATTTTATACAGTTTTCACTCCCATGTTA
AATCCTTTAATCTACACTTTAAGAAATTCAGAGATGAAAAATTCTATGCAAAAACTCTGG
TGTACACTGTTAACTATGGATAGAATAAGATTGTCTTGTTAT


Conceptual translation

MGERNNVTEFVLLGLTQDPAGQKVLFVMFLLIYIVTMVGNLLIVLMVIASPSLGSPMYFF
LACLSFLDIVYSTSISPKLIMDLLCDEKSISFTACMSQLFIEHLFGGTEIVILVAMAYDR
YVAICKPLHYLTIMNRKVCIILLGFSWVGGFTHSMIQILFVFNLPFCGPNIIDHFMCDMS
PLLGLVCTDTYFIGLTLIANGGAMCIVVFILLIVSYGIILKSLKNYSQEGRRKALSTCSS
HIMVVTLFFVPCIFMYARPVYNFSSDKYITVFYTVFTPMLNPLIYTLRNSEMKNSMQKLW
CTLLTMDRIRLSCY