Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a74 Olfactory Receptor

Gene Symbol Or4a74
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89609159-89610100 (-)
Aliases Olfr1247, RP23-150I5.6, MOR231-6, RP23-150I5.6, MOR231-6

Sequence information


Nucleotide sequence

ATGGGAGAGACTAACAATGTCACAGAATTTGTCCTTCTGGGCCTCACTCAGGATCCTACT
GGGCAAAAAGCATTGTTTGTCATGTTTTTGCTCATGTACATTGTGACTATTGTGGGCAAC
CTGCTCATCGTGGGGACAGTGATTGCCAGCCCCTCCTTGAATTCCCCAATGTACTTCTTC
CTTGCCTTTCTGTCACTCATGGATGCTGTTTATTCTACTGCCATCTTGCCCAAGTTGCTT
AAAGACTTAGTTTGTGATAAAAAGACCATCTCCTTCACAGCTTGTCTGGTTCAGCTCTTT
GTAGAGCACTTATTTGGTGGTGCTGAGGTCTTCCTTCTGGTGGTGATGGCCTATGATCGC
TATGTGGCCATCTGTAAGCCACTGCACTATTTAACTGTCATGAATCAACAGGTTTGTATC
TCACTTTTGGTGGTAGCCTGGGTTGGGGGATTTGCACATGCTCTGGTTCAAGTTCTCTCT
GTATATAAACTTCCTTTCTGTGGACCTAATGTCATTGATCACTTTGGCTGTGACATGTAT
CCTTTATTGGCACTTGTGTGCACTGACACCTACTTTATTGGCCTCACGGTAGTTGCCAAT
AATGGAGCCATGTGTATGGTAGTCTTTGTCCTTCTTCTATTTTCCTATGGAATTATCTTA
AGCTCCCTTAAGACTCACAGTCAGGAAGGGAGGCGCAAAGCCCTGTCCACCTGCAGCTCC
CACATCATGGTTGTTGTTCTTTTCTTTGTTCCCTGTATATTCATGTATGTTAGACCTGTC
TCCAACTTCCCTATTGATAAATCTATTTCTGTTTTTTATACAGCTATTACTCCCATGTTG
AATCCTTTGATATATACATTGAGAAATTCAGAGATTAAAAATTCTATGGGAAAGCTCTGG
AGTAAAATGATAAGTATAGATAGAGTAAGAATTTTTGCATAC


Conceptual translation

MGETNNVTEFVLLGLTQDPTGQKALFVMFLLMYIVTIVGNLLIVGTVIASPSLNSPMYFF
LAFLSLMDAVYSTAILPKLLKDLVCDKLAVYNLPFCGPNIIDHFGCDIYPLLLLACTDTY
FIGLSVIGNNGAMCIVIFILLLLSYGIILRSLKNHSQEGRRKALSTCGSHITVVFLFFVP
CIFMYVRPVSSFPIDKSITVIYTIVTPMLNPLIYTLRNSEMKISMEKLLQKTLSPCRIRL
SSCCLCY