Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a77c Olfactory Receptor

Gene Symbol Or4a77c
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78339847-78340788 (-)
Aliases Olr713, Olr713

Sequence information


Nucleotide sequence

ATGGGACAGAAAAACAATGTTACTGAGTTTATCCTCCTGGGTCTCACTCAGGATCCTGCT
GGGCAAAAAGCTTTATTTGTCATGTTTTTACTCATCTACATTGTGACAATGGTGGGAAAT
CTGCTCATTGTGGGGACAGTGATTGCCAGCCCCTCACTGGGCTCCCCAATGTACTTCTTC
CTTGCCTTTCTCTCACTCATGGATGCTGTTTATTCTACTGCCATCTTGCCCAAGTTGCTT
ACAGATTTACTCTGTGATAAGAAGACCATTTCCTTCACAGCTTGTCTGGTTCAGCTTTTT
GTGGAGCACTTATTTGGTGGTTCTGAGGTCTTCATTTTGGTGGTGATGGCCTATGATCGC
TATGTGGCCATCTGTAAGCCACTGCACTATTTGACCATAATGAATCGGCAAGTTTGCATT
CTCTTGTTGGTGGTGTCCTGGGCTGGAGGATTTGCACATGCTCTGCTTCAAGTGATCTCT
GCATATTTACTTCCTTTTTGTGGACCCAATGTCATTGACCATTTTATCTGTGATATGTAC
CCATTGTTAGGACTTGCATGTACTGATACCTTCTTCCTTGGACTCAGTGTAATTGGAAAT
AATGGAGCAATGTCTATAGTGGTCTTTATCCTCCTCCTTGTCTCCTATGGAATCATTCTA
AACTCTTTTAAGACTCACAGTCCAGAAGGGAGACGCAAAGCCCTGTCTACCTGTAGCTCT
CACATCATGGTTGTCATCCTCTTTTTTGTTCCTTGTATTTTCACGTATGTTAGACCTGTG
TCCAACTTTCCAATTGATAAATATATTACTGTCTTTTATACAATTTTTACTCCCATGTTG
AACCCTTTAATATATACCTTGAGAAACTTAGAGATTAGAAATTGTATGGCAAAGCTGTGG
GGTAAAATGTTCACTAAAGACATAAAAAGAGCTTCTCCTCAC


Conceptual translation

MGQKNNVTEFILLGLTQDPAGQKALFVMFLLIYIVTMVGNLLIVGTVIASPSLGSPMYFF
LAFLSLMDAVYSTAILPKLLTDLLCDKKTISFTACLVQLFVEHLFGGSEVFILVVMAYDR
YVAICKPLHYLTIMNRQVCILLLVVSWAGGFAHALLQVISAYLLPFCGPNVIDHFICDMY
PLLGLACTDTFFLGLSVIGNNGAMSIVVFILLLVSYGIILNSFKTHSPEGRRKALSTCSS
HIMVVILFFVPCIFTYVRPVSNFPIDKYITVFYTIFTPMLNPLIYTLRNLEIRNCMAKLW
GKMFTKDIKRASPH