Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a77d Olfactory Receptor

Gene Symbol Or4a77d
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78639314-78640261 (-)
Aliases Olr717, Olr717

Sequence information


Nucleotide sequence

ATGGGACAGAATAACAGTGTATCAGAGTTTATACTCTTGGGACTCACTGAGGATCCTGCT
GGGCAGAAAACATTATTTGTGGTATTTTTACTCATCTATATTGGAACAATGGTGGGCAAC
CTGCTCATTGTGTGGACAGTGATTGCCAGCCCTTCTCTAGACTCCCCAATGTACTTCTTC
CTTGCCTATCTGTCACTCATAGATGCCCTTTATTCCAGTACTATTTTACCCAAGTTACTT
ATAGACCTACTCTGTGATAAAAAGACCATTTCCCTCACAGCTTGCTTGGTACAATTGTTT
GTAGAGCATTTATTTGGTGGTGTTGAGATCTTCCTTCTAGTTTTTATGGCCTATGATCGC
TATGTGGCCATTTGTAAGCCCCTGTACTATTTGACCATCATGAATCAACGGGTCTGTGTC
TGTTTGGTGGTGGTGTCTTGGATTGGAGCATTTGCCCATGCTCTGGTTCAAGTTTTCTCT
GTGTATAAACTTCCTTTCTGTGGCCCTAACATCATTGATCACTTTGCTTGTGACATGTAC
CCATTGTTAGGACTTGCTTGTACTGACACTTACTTCCTTGGGCTCACTGTAGTTGGCAAT
AATGGAGCAATATCTGTAGTGGTCTTTATGCTCCTCCTTCTCTCTTATGGAATAATTCTA
AATTCTCTGAAGACTCACAGTCAGGAAGGGAGGCGCAAGGCCCTGTCCACCTGCAGCTCC
CATATCATGGTGATTGTTCTCTTTTTTGTTCCTTGCATTTTCATGTATGTTAGACCTGTT
TCTAACTTTCCTCTTGACAAATTCATTACTGTGTTTTATACAGTGTTCACTCCAATGTTG
AATCCTTTAATATATACTTTGAGAAATTTAGAGATTAAAAAATCTATGGAAAAACTCTGC
CGTAAAATATTTACTTCAGACAGAATAAGAATTTCTTCTTGTTATTCC


Conceptual translation

MGQNNSVSEFILLGLTEDPAGQKTLFVVFLLIYIGTMVGNLLIVWTVIASPSLDSPMYFF
LAYLSLIDALYSSTILPKLLIDLLCDKKTISLTACLVQLFVEHLFGGVEIFLLVFMAYDR
YVAICKPLYYLTIMNQRVCVCLVVVSWIGAFAHALVQVFSVYKLPFCGPNIIDHFACDMY
PLLGLACTDTYFLGLTVVGNNGAISVVVFMLLLLSYGIILNSLKTHSQEGRRKALSTCSS
HIMVIVLFFVPCIFMYVRPVSNFPLDKFITVFYTVFTPMLNPLIYTLRNLEIKKSMEKLC
RKIFTSDRIRISSCYS