Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a78 Olfactory Receptor

Gene Symbol Or4a78
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78570765-78571715 (-)
Aliases Olr712, Olr712

Sequence information


Nucleotide sequence

ATGGGCCAGAGCAACAATGTCACAGAATTTGTCCTGCTGGGCTTCACTCAGGATCCTGCT
GGGCAAAAAGCTTTATTTGTTATGTTTTCACTGATGTACATTGCAACAATGGTGGGGAAC
CTGCTCATTGTAGGGACAGTGATTGTCAGCCCCTCCTTAGGCTCCCCGATGTACTTCTTC
CTTGCCTCTCTGTCACTCATGGATGCTGTTTATTCTACTGCCATCTCACCCAAGTTGATT
GTAGACTTGCTCCGTGAGAAAAAGACCATCTCCTTCAGAGCTTGCATAAGCCAGCTCTTT
ATAGAGCATTTATTTGGCGGGGTTGACATTGTTATTCTGGTGGCAATGGCCTATGATCGC
TATGTGGCCATCTGTAAGCCACTACATTATTTGACCATCATGAATCGACGGGTATGTATT
CTCTTCTTGGTGATGGCCTGGGCAGGAGGTTTTGCACATGCTTTGTTTCAAGTTCTTGCT
GTATATAATCTTCCTTTCTGTGGTCCCAATATCATTGACCACTTTGGGTGTGACATATAC
CCACTCTTGCTACTTGCATGTACTGACACCTACTTCATTGGACTTTCTGTCATTGGCAAT
AATGGGGCCATGTGTATAGTCATCTTTAGTCTCCTTTTATTTTCCTATGGAATAATTCTT
AGATCTCTCCAGAATCACAGTCAGGAAGGGAGGCGCAAAGCTCTGTCCACCTGCAGCTCT
CATATCACTGTGGTTTTTCTCTTTTTTGTTCCCTGTATTTTCATGTACGTTAGACCTGTT
TCTAGTTTTCCTATTGACAAATCCATCACTGTAATTTATACTGTTGTCACCCCCATGTTG
AATCCTTTAATATATACTTTGAGAAATTCAGAGATGAAAAATTCTATGGAAAAGCTCCTG
CAGAAAATATTAAGTCCAAATAGAGTAAGGCTTCTTTGCTGCTTACATTAT


Conceptual translation

MGQSNNVTEFVLLGFTQDPAGQKALFVMFSLMYIATMVGNLLIVGTVIVSPSLGSPMYFF
LASLSLMDAVYSTAISPKLIVDLLREKKTISFRACISQLFIEHLFGGVDIVILVAMAYDR
YVAICKPLHYLTIMNRRVCILFLVMAWAGGFAHALFQVLAVYNLPFCGPNIIDHFGCDIY
PLLLLACTDTYFIGLSVIGNNGAMCIVIFSLLLFSYGIILRSLQNHSQEGRRKALSTCSS
HITVVFLFFVPCIFMYVRPVSSFPIDKSITVIYTVVTPMLNPLIYTLRNSEMKNSMEKLL
QKILSPNRVRLLCCLHY