Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4a80 Olfactory Receptor

Gene Symbol Or4a80
Organism Rat
Family 4
Subfamily a
Pseudo No
Location chr3:78,361,200-78,362,100 (-)
Aliases Olr714

Sequence information


Nucleotide sequence

ATGGGCCAGAGCAAAATTGTCACAGAATTTGTCCTGCTGGGCTTCACTCAGGATCCTGCT
GGGCAAAAAGCTTTATTTGTTATGTTTTCACTGATGTACATTGCAACAATGGTGGGCAAC
CTGCTCATTGTAGGGACAGTGATTGTCAGCCCCTCCTTAGGCTCCCCAATGTACTTCTTC
CTTGCCTCTCTGTCACTAATGGATGCTGTTTATTCTACTGCCATCTCACCCAAGTTGATT
GTAGACTTGCTCCGTGAGAAAAAGACCATCTCCTTCAGAGCTTGCATAAGCCAGCTCTTT
ATAGAGCATTTATTTGGTGGGGTTGACATTGTCATTCTGGTGGCAATGGCCTATGATTGC
TATGTGGCCATCTGTAAGCCACTACATTATTTGATCATCATGAATCGACGCGTATGTATC
CTCTTCTTGGTGATGGCCTGGGCAGGAGGTTTTGCACATGCTTTGTTTCAAGTTCTTGCT
GTATATAATCTTCCTTTCTGTGGTCCCAATATCATTGACCACTTTGGCTGTGACATATAC
CCGCTCTTGCTACTTGCATGTACTGACACCTACCTGATTGGTCTCACTATCATTGCTAAT
GGTGGAGCCATGTGTATAGTCATCTTCATCCTACTTCTACTTTCTTATGCAATAATCCTA
AGATCTCTCCAGAATCACAGTCAGGAAGGGAGGCACAAAGCTCTGTCCACCTGCAGCTCT
CATATCACTGTGTTTTTTCTCTTTTTTGTTCCCTGTATTTTAATGTATGTTAGACCTGTT
TCTAGTTTTCCTATTGACAAATCCATCACTGTAATTTATACTGTTGTCACCCCCGTGTTG
AATCCTTTAATATATACTTTGAGAAATTCAGAGATGAAAAATTCTATGGAAAAGCTCCTG
CAGAAAATATTAAGTCCGAATAGACTAAGGCTTCTTTGCTGCTTATATTAT


Conceptual translation

MGQSKIVTEFVLLGFTQDPAGQKALFVMFSLMYIATMVGNLLIVGTVIVSPSLGSPMYFF
LASLSLMDAVYSTAISPKLIVDLLREKKTISFRACISQLFIEHLFGGVDIVILVAMAYDC
YVAICKPLHYLIIMNRRVCILFLVMAWAGGFAHALFQVLAVYNLPFCGPNIIDHFGCDIY
PLLLLACTDTYLIGLTIIANGGAMCIVIFILLLLSYAIILRSLQNHSQEGRHKALSTCSS
HITVFFLFFVPCILMYVRPVSSFPIDKSITVIYTVVTPVLNPLIYTLRNSEMKNSMEKLL
QKILSPNRLRLLCCLYY