Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a81 Olfactory Receptor

Gene Symbol Or4a81
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89788409-89789350 (-)
Aliases Olfr1254, RP23-270H4.3, MOR231-13, RP23-270H4.3, MOR231-13

Sequence information


Nucleotide sequence

ATGGGAAAGAATAACAATGTTACAGAATTTATTCTACTGGGTCTCACTCAGGATCCTGTT
GGCCAAAAAGCATTATTTGTCTTGTTTCTACTCATGTACATTGTGACCATGGCAGGCAAT
TTGATTATTGTGGTAACAATCATTGCCAGCCCCTCCTTGAGCTCCCCAATGTACTTCTTC
CTTGCCTATCTGTCACTCATGGATGCTATTTATTCCACTGCAATCTCACCCAAGTTGATT
ATGGACTTACTCTGCAATAAAAAGACTATCTCTTTCAGAGCTTGCATGGGCCAACTCTTT
GTGGAACACTTATTTGGTGCAACTGAGATCTTCCTTCTGGTAGCAATGGCTTATGATCGC
TATGTTGCCATTTGTAAACCACTGCACTATTTAACCATCATGAATCACCGGGTTTGCATT
CTCCTGGTGATGGCAACCTGGGTTGGAGGGTTTGCACACTCCATGGCTCAAGTTCTCTTT
GTTTACGATCTTCCTTTCTGTGGTCCCAATGTCATTGACCATTTTGCCTGTGATATGTAT
CCATTATTGGTGCTTGTGTGCTCTGACACCTACTTCCTTGGTCTTACTGTCATTGCCAAC
GATGGAGCAATCTGTATGGTGGTGTTTGTTATTCTGTTAGCCTCCTATGGAATCATTCTA
AACTCTCTTAAGACTCACAGTCAGGAAGGGAGGCGCAAAGCCCTGTCCACTTGCAGTTCT
CACATCATGGTCGTTATCCTATTTTTTGTTCCTTGCATTTTCATGTATGTTAGACCTGTC
TCCAATTTTCCTGTTGATAAATCAGTTACTATTTTTTATACAGTTGTCACTCCTATGTTG
AATCCCTTAATATACACCTTGAGAAATTCAGAGATAAAACATTCTATGCTAAAACTCTGG
TCTAAAATATTACATTCAGATAGACTAAGGAAATCTTGTTGT


Conceptual translation

MGKNNNVTEFILLGLTQDPVGQKALFVLFLLMYIVTMAGNLIIVVTIIASPSLSSPMYFF
LAYLSLMDAIYSTAISPKLIMDLLCNKKTISFRACMGQLFVEHLFGATEIFLLVAMAYDR
YVAICKPLHYLTIMNHRVCILLVMATWVGGFAHSMAQVLFVYDLPFCGPNVIDHFACDMY
PLLVLVCSDTYFLGLTVIANDGAICMVVFVILLASYGIILNSLKTHSQEGRRKALSTCSS
HIMVVILFFVPCIFMYVRPVSNFPVDKSVTIFYTVVTPMLNPLIYTLRNSEIKHSMLKLW
SKILHSDRLRKSCC