Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4b1 Olfactory Receptor

Gene Symbol Or4b1
Organism Mouse
Family 4
Subfamily b
Pseudo No
Location chr2:90149093-90150004 (-)
Aliases Olfr1270, RP23-226K16.3, MOR227-1, RP23-226K16.3, MOR227-1

Sequence information


Nucleotide sequence

ATGGCCAGGGAAAATAACGTGACTGAATTGATCATCACCGGCCTTTTCCAGGATCCAAAT
GTGCAGAAGGTGTGCTTTGTGCTGTTCCTTCCTGTGTACCTGGCCACAGTGTTGGGCAAT
GGCCTCATTGTTGCAATGGTCATTGTCAGTAAGAGTCTGCATTCTCCCATGTACATCTTC
CTCAGCTCCTTGTCCCTGGTGGAGATCTGTTACTCTTCTACTGTTGTCCCTAAGTTCATC
ACTGACTTACTTGCTAAGGTTAAAACCATCTCGCTGAAGGGCTGTCTGGCTCAGATATTC
TTCTTCCATTTCTTGGGAGTGGCTGAGATATTTTTGCTTGTGGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAACCTCTTCATTACATGAATATCATGAGTCGTCAAGTGTGTCAC
GTGCTGGTGGCTGTTTCTTGGCTGGGGGGCTTTTTACATTCTATAATTCAGGTTCTTATC
TCTATTCAGTTGCCCTTCTGTGGTCCCAATGTGATTGACCACTACTTCTGTGACCTGCAG
CCATTATTCAAGCTGGCTTGCACTGATACATTTGTGGAGAGTGTCATTGTAATGGCCAAT
AGTGGTTTAATTGCTCTGTGTTCCTTCCTTGTCTTGGTGTCCTCCTATGTCATCATCCTT
GTCAATTTGAGGAAGCATTCTGCAGAGGGGAGACGCAAGGCCCTCTCCACCTGTGCCTCT
CACATCACAGTGGTCGTCTTGTTCTTTGGACCCGCCATCTTCCTCTACATGAGACCTTCC
TCTACTTTCACTGAAGACAAGCTTGTGGCTGTGTTCTACACGGTCATCACCCCTATGCTG
AATCCCATCATCTACACACTCAGAAATGCAGAGGTGAAAAATGCTGTGAGGAAGTTGTGG
GGAAAAAGAATA


Conceptual translation

MARENNVTELIITGLFQDPNVQKVCFVLFLPVYLATVLGNGLIVAMVIVSKSLHSPMYIF
LSSLSLVEICYSSTVVPKFITDLLAKVKTISLKGCLAQIFFFHFLGVAEIFLLVVMAYDR
YVAICKPLHYMNIMSRQVCHVLVAVSWLGGFLHSIIQVLISIQLPFCGPNVIDHYFCDLQ
PLFKLACTDTFVESVIVMANSGLIALCSFLVLVSSYVIILVNLRKHSAEGRRKALSTCAS
HITVVVLFFGPAIFLYMRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKNAVRKLW
GKRI