Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4b1 Olfactory Receptor

Gene Symbol Or4b1
Organism Rat
Family 4
Subfamily b
Pseudo No
Location chr3:79120697-79121686 (-)
Aliases Olr741, Olr741

Sequence information


Nucleotide sequence

ATGGTTCTCCAATGTTTTATTTTAGGAAGTTCACTGCCTGATGTCCACTACTCCCCAACT
GAACCCATGGCAAGGGCAAATAACGTGACTGAATTGATCATCACTGGCCTTTTCCAGGAT
CCAAATGTGCAGAAAGTGTGCTTTGTGCTGTTCCTTCCTGTGTACATGGCCACCGTGTTG
GGCAACGGCCTCATCGTTGCAATGGTCAGTGTCAGTAAGAGTCTGCATTCTCCCATGTAT
ATCTTCCTCAGCTCATTGTCCCTAGTGGAGATCTTCTACTCTTCTACTGTTGTCCCTAAG
TTCATCACCGATTTACTTGCTAAGGTTAAAACCATCTCTCTGAACGGCTGTCTGGCACAG
ATATTCTTCTTCCATTTCTTGGGGGTGGCTGAGATATTTTTGCTTGTGGTGATGGCCTAT
GACCGCTATGTGGCCATCTGCAAACCTCTTCATTACATGAACATCATGAGTCGTCAAGTA
TGCCACACGCTGGTGGCTGTTTCTTGGCTGGGGGGCTTCTTACATTCTATAATTCAGGTT
CTTATCACTATTCAGCTGCCCTTCTGTGGTCCCAATGTGATTGACCACTACTTCTGTGAC
CTCCAGCCATTATTCAAGCTGGCTTGTACTGACACATTTGTGGAAAGTGTCATTGTAATG
GCCAATAGTGGCTTAATTGCTCTGTGTTCCTTCCTTGTCTTGGTATCCTCCTATGTCATC
ATTCTGATCAATTTGAGGAACCATTCTGCAGATGGGAGACATAAGGCTCTCTCCACCTGT
GCCTCTCACATCACGGTGGTCATCTTGTTCTTTGGACCTGCCATCTTCCTCTACATGAGA
CATTCCTCTACTTTCACTGAAGACAAACTTGTAGCTGTGTTTTACACAGTCATTACCCCC
ATGCTGAACCCTATTATCTACACCCTGAGAAATGCAGAGGTGAAAAATGCTGTGAGGAAG
TTGTGGGGCAAAAAGAACATAGGGATAAAG


Conceptual translation

MVLQCFILGSSLPDVHYSPTEPMARANNVTELIITGLFQDPNVQKVCFVLFLPVYMATVL
GNGLIVAMVSVSKSLHSPMYIFLSSLSLVEIFYSSTVVPKFITDLLAKVKTISLNGCLAQ
IFFFHFLGVAEIFLLVVMAYDRYVAICKPLHYMNIMSRQVCHTLVAVSWLGGFLHSIIQV
LITIQLPFCGPNVIDHYFCDLQPLFKLACTDTFVESVIVMANSGLIALCSFLVLVSSYVI
ILINLRNHSADGRHKALSTCASHITVVILFFGPAIFLYMRHSSTFTEDKLVAVFYTVITP
MLNPIIYTLRNAEVKNAVRKLWGKKNIGIK