Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4b12 Olfactory Receptor

Gene Symbol Or4b12
Organism Mouse
Family 4
Subfamily b
Pseudo No
Location chr2:90265514-90266428 (-)
Aliases Olfr1271, RP23-226K16.6, MGC123497, MGC123514, MOR227-5, RP23-226K16.6, MGC123497, MGC123514, MOR227-5

Sequence information


Nucleotide sequence

ATGGTCCATGAAAATAACGTAACTGAGTTAATTTTCACTGGCCTTTTCCAGGATCCAGAG
GTTCAGAAGGTGTGCTTTGTGCTGTTCCTTCCTGTGTACCTGGCCACATTGCTGGGCAAC
GGTCTTATTTTTGTGACAGTCAGCATCAGTAAGACTTTACATTCTCCCATGTACTTCTTC
CTCAGTTCCTTGTCCCTGGTGGAGATCTGCTACTCCTCTACAGTTGCCCCTAAGTTCATC
ACTGACTTACTTGCTAAGGTTAAAACCATCTCTCTGAAGGGCTGTCTAACTCAGATATTC
TTCTTCCATTTCTTTGGTGTTGTTGAAATCATTTTGCTAGTGATGATGGCCTACGATCGC
TATGTGGCCATCTGCAAACCTCTTCATTACATGATCATCATGAGTCGTCAAGTGTGTCAC
ATGTTGGTGGCTGGCTCCTGGCTGGGGGGCCTCATTCACTCCATAATCCAGATCATCATC
ACTATTCCATTGCCCTTCTGTGGTCCCAATGTGATTGACCACTACTTCTGTGACCTGCAT
CCATTACTTAAGCTTGCTTGCAGTGACACCTTTATGGAGAGGTTTATTGTAATGGCTAAC
AGTGGTCTATTCTCTATAATCTCTCTCTTCATCTTGGTGTCCTCCTATGCTGTCATCCTA
ATCAGCTTGAGGAAGCGTTCTGCAGAGGGGAGACGGAAGGCCCTCTCTACCTGTGCCTCA
CACATCACAGTGGTCATCCTGTACTTTGGACCTGGTGCATTTATTTATATGAGACCCTCC
TCTGCCTTCACTGAAGACAAGCTTGTGTCTGTGTTCTACACTGTCATCACTCCCATGCTG
AACCCCATTGTCTATACTCTAAGGAATACAGAAATGAAAAATGCTATACGTATGTTCTGG
AGCCAAAAAGACAAG


Conceptual translation

MVHENNVTELIFTGLFQDPEVQKVCFVLFLPVYLATLLGNGLIFVTVSISKTLHSPMYFF
LSSLSLVEICYSSTVAPKFITDLLAKVKTISLKGCLTQIFFFHFFGVVEIILLVMMAYDR
YVAICKPLHYMIIMSRQVCHMLVAGSWLGGLIHSIIQIIITIPLPFCGPNVIDHYFCDLH
PLLKLACSDTFMERFIVMANSGLFSIISLFILVSSYAVILISLRKRSAEGRRKALSTCAS
HITVVILYFGPGAFIYMRPSSAFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMFW
SQKDK