Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4b13 Olfactory Receptor

Gene Symbol Or4b13
Organism Mouse
Family 4
Subfamily b
Pseudo No
Location chr2:90252072-90252986 (-)
Aliases Olfr142, RP23-226K16.5, K20, MOR227-2, RP23-226K16.5, K20, MOR227-2

Sequence information


Nucleotide sequence

ATGGCCAACAAAAATAATGTAACCGAGTTAATTTTCACTGGCCTTTTCCAGGATCCAGAG
GTTCAGAAGGTGTGCTTTGTGCTGTTCCTTCCTGTGTACCTGGCCACATTGCTGGGCAAC
AGTCTTATTCTTGTGGCAGTCAGCATCAGTAAGACTTTACATTCTCCCATGTACTTCTTC
CTCAGTTCCTTGTCCCTGGTGGAGATCTGTTACTCCTCTACAATTGTCCCTAAGTTCATC
ACTGACTTACTTGCTAAGGTTAAAACCATCTCTCTGAAGGGCTGTCTGACTCAGATATTC
TTTTCCCATTTCTTTGGTGTTGTTGAAGTCATTTTGCTAGTGGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAACCTCTTCATTACATGAACATCATGAGTCGTCAAGTGTGTCAC
ATGCTGGTGGCTGGCTCCTGGCTGGGGGGCTTCATTCACTCCATAATCCAGATCATCATC
ACTATTCCATTGCCCTTCTGTGGTCCCAATGTGATTGACCACTACTTCTGTGACCTGCAA
CAATTATTTAAGCTTGCCTGCACTGACACCTTTATGGAGGGGTTTATTGTGATGGCCAAC
AGTGGTTTAATCTCTATAGTCTCTCTCTTCATCTTGGTGTCCTCCTATGCTGTCATCCTA
ATCAGCTTGAGGAAGCGTTCTGCAGAGGGGAGGCGCAAGGCTCTCTCCACCTGTGCCTCT
CACATCACAGTGGTCATCCTGTTCTTTGTGCCTGGTGCATTTATTTATATGAGACCTTCC
TCCACCTTCACTGAAGATAAGCTTGTGTCTGTGTTCTACACTGTCATTACCCCTATGCTG
AACCCCATTGTCTATACTCTAAGGAATACAGAAATGAAAAATGCTATACGAATGTCCTGG
AAGCAAAAGGACAGC


Conceptual translation

MANKNNVTELIFTGLFQDPEVQKVCFVLFLPVYLATLLGNSLILVAVSISKTLHSPMYFF
LSSLSLVEICYSSTIVPKFITDLLAKVKTISLKGCLTQIFFSHFFGVVEVILLVVMAYDR
YVAICKPLHYMNIMSRQVCHMLVAGSWLGGFIHSIIQIIITIPLPFCGPNVIDHYFCDLQ
QLFKLACTDTFMEGFIVMANSGLISIVSLFILVSSYAVILISLRKRSAEGRRKALSTCAS
HITVVILFFVPGAFIYMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMSW
KQKDS