Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4b13 Olfactory Receptor

Gene Symbol Or4b13
Organism Rat
Family 4
Subfamily b
Pseudo No
Location chr3:79089722-79090636 (-)
Aliases Olr740-ps, Olr740-ps

Sequence information


Nucleotide sequence

ATGGCCAATGAAAATAATGTAACTGAGTTAATTTTCACTGGCCTTTTCCAGGACCCAGAG
GTACAGAAGGCGTGCTTTGTGCTGTTCCTTCCTGTGTATGTGGCCACATTGCTGGGCAAC
AGTCTTATTATTGTGGCAGTCAGCGCCAGTAAGACTTTACATTCTCCCATGTACTTCTTC
CTTAGCTCCTTGTCCCTGGTGGAAATCTGCTACTCCTCTACAATTGTCCCTAAGTTCATC
ACCGACTTACTTGCTAAGATTAAAACCATCTCTCTGAAGGGCTGCCTCACTCAGATATTT
TTCTCCCATTTCTTGGGGGTTGTTGAAGTCATTTTGCTAGTGGTGATGGCCTATGACCGC
TACGTGGCCATCTGCAAACCTCTTCATTACATGAACATCATGAGTCGTCAAGTGTGTCAC
ATGCTGGTGGCTGGTTCCTGGCTGGGGGGCCTCATTCACTCCATAATCCAGATCCTCATA
ACCATCCCATTGCCCTTCTGCGGTCCCAATGTAATTGACCACTACTTCTGCGACCTGCAG
CCATTATTCAAGCTTGCCTGCACTGACACCTTTCTGGAGGGGGTTATTGTGATGGCCAAC
AGTGGTCTAATCTCTATAATCTCTCTCTTCATCTTGGTGTTCTCCTATGCCATCATTTTA
GTCAGCTTGAGGAACCATTCTGCAGAGGGGAGGCGCAAGGCCTTGGCTACCTGTGCCTCT
CACATCACAGTGGTCATCTTGTTCTTTGGGCCTGGTGCGTTTATTTATATGAGACCTTCC
TCCACCTTCACTGAAGACAAGCTTGTGTCTGTATTCTACACGGTCATCACTCCCATGCTG
AACCCCATTGTCTATACACTACGGAATACAGAAATGAAAAATGCTATAAGAATGTTCTGG
AACCAAAAAGAGAAT


Conceptual translation

MANENNVTELIFTGLFQDPEVQKACFVLFLPVYVATLLGNSLIIVAVSASKTLHSPMYFF
LSSLSLVEICYSSTIVPKFITDLLAKIKTISLKGCLTQIFFSHFLGVVEVILLVVMAYDR
YVAICKPLHYMNIMSRQVCHMLVAGSWLGGLIHSIIQILITIPLPFCGPNVIDHYFCDLQ
PLFKLACTDTFLEGVIVMANSGLISIISLFILVFSYAIILVSLRNHSAEGRRKALATCAS
HITVVILFFGPGAFIYMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMFW
NQKEN