Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4b13b Olfactory Receptor

Gene Symbol Or4b13b
Organism Rat
Family 4
Subfamily b
Pseudo No
Location chr3:79,132,800-79,133,700 (-)
Aliases Olr742

Sequence information


Nucleotide sequence

ATGGCCAATGAAAATAATGTAACTGAGCTAATTTTCACTGGCCTTTTCCAGGACCCAGAG
GTACAGAAGGTGTGCTTTGGGCTGTTCCTTCCTGTGTATGTGGCCACATTGCTGGGCAAC
AGTCTTATTATTGTGGCAGTCAGCGCGAGTAAGACTTTACATTCTCCCATGTACTTCTTC
CTCAGCTCCTTGTCTCTGGTGGAGATCTTCTACTCCTCTACGATTGCCCCTAAGTTCATC
ACCGACTTACTTGCTAAGATAAAAACCATCTCTCTGAAGGGCTGCCTCACTCAGATATTT
TTCTTTCATTTTTTTGGGGTTGTTGAAGTCATTTTGCTAGTGGTGATGGCCTATGACCGC
TACGTGGCCATCTGCAAACCTCTTCATTACATGTACATCATGAGTCGTCTAGTGTGCCAA
AGGCTGGTGGCTGGTTCCTGGCTGGGGGGCCTCATTCACTCCATAATCCAGATCCTCATC
ACCATCCCATTGCCCTTCTGCGGTCCCAATGTGATTGACCACTACTTCTGCGACCTGCAG
CCATTATTCAAGCTTGCCTGCACTGACACCTTTCTGGAGGGGGTTATTGTGATGGCCAAC
AGTGGTCTAATCTCTATAATCTCTCTCTTCATCTTGGTGTCCTCCTATGCCATCATTTTA
GTCAGCTTGAGGAACCATTCTGCAGAGGGGAGGCGCAAGGCCCTGGCCACCTGTGCCTCT
CACATCACGGTGGTCTTCTTGTACTTTGGGCCTGGTGCGTTTATTTATATGAGACCTTCC
TCCACCTTCACTGAAGACAAGCTTGTGTCTGTGTTCTACACGGTCATCACCCCCATGCTG
AACCCCATTGTCTATACACTACGGAATACAGAAATGAAAAATGCTATAAGAATGTTCTGG
AACCAAAAAGAGAAT


Conceptual translation

MANENNVTELIFTGLFQDPEVQKVCFGLFLPVYVATLLGNSLIIVAVSASKTLHSPMYFF
LSSLSLVEIFYSSTIAPKFITDLLAKIKTISLKGCLTQIFFFHFFGVVEVILLVVMAYDR
YVAICKPLHYMYIMSRLVCQRLVAGSWLGGLIHSIIQILITIPLPFCGPNVIDHYFCDLQ
PLFKLACTDTFLEGVIVMANSGLISIISLFILVSSYAIILVSLRNHSAEGRRKALATCAS
HITVVFLYFGPGAFIYMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMFW
NQKEN