Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4b1b-ps Olfactory Receptor

Gene Symbol Or4b1b-ps
Organism Rat
Family 4
Subfamily b
Pseudo Yes
Location chr3:79151114-79152239 (-)
Aliases Olr743-ps, Olr743-ps

Sequence information


Nucleotide sequence

TGAGAATGCATTTAGTGAAATTAACTCATGTGTGCTGCAATCTTGTGATCTTTTTTCAGC
CTTCCTACTATGTGATGTCCAACACACTTGAGCTGACTCCATGGCCAATGAAAATAATGT
AACTGAGTTAATTTTCACTGGCCTTTTCCAGGACCCAGAGGTACAGAAGGTGTGCTTTGT
GCTGTTCCTTCCTGTGTATGTGGCCACATTGCTGGGCAACGGTCTTATTATTGTGGCAGT
CAGCACGAGTAAGACTTTACATTCTCCCATGTACTTTTTCCTCAACTCCTTGTCTCTGGT
GGAGATCTTCTACTCCTCTACGATTGTCCCTAAGTTCATCACTGACTTACTTGCTAAGAT
TAAAACCATCTCTCTGAAGGGCTGCCTTACTCAGATATTTTTCTCCCATTTCTTGGGGGT
TGCTGAGATTCTCCTCCTTGTGGTGATGGCCTATGACCGCTACGTGGCCATCTGCAAACC
TCTTCATTACATGAACATCATGAGTCGTCAAGTGTGTCACATGCTGGTAGCTGGTTCCTG
GCTGGGGGGCCTCATTCACTCCATAATCCAGATCCTCATCACCATCCCATTGCCCTTCTG
CGGTCCCAATGTGATTGACCACTACTTCTGCGACCTGCAGCCATTATTCAAGCTTGCCTG
CACTGACACCTTTCTGGAGGGGTTATTGTGATGGCCAACAGTGGTCTAATCTCTATAATC
TCTCTCTTCATCTTGGTGTCCTCCTATGCCATCATTTTAGTCAGCTTGAGGAACCATTCT
GCAGAGGGGAGGCACAAAGCCCTGGCTACCTGTGCTTCTCACATCACGGTGGTCATCTTG
TTCTTTGGACCTGCCATCTTCATTTATCTGCGACCCTCTTCCAGCTTCACTGAAGACAAG
CTTGTGTCTGTGTTCTACACGGTCATCACTCCCATGCTGAACCCCATCATCTACACACTG
AGAAATGCAGAGGTGAAAAATGCTGTGAGGAAGTTGTGGGGAAAAAGGGACACAGAGATA
GAGTGAAAAGAGCAAGAAGGCATGGGAAAGGATTTTAAGTTAGTCTGTTGCTGTTGTTGT
GAATTCTGTTTTTTTGGGTTCATGTTTAATTTACATTTCATCAACA


Conceptual translation

MANENNVTELIFTGLFQDPEVQKVCFVLFLPVYVATLLGNGLIIVAVSTSKTLHSPMYFF
LNSLSLVEIFYSSTIVPKFITDLLAKIKTISLKGCLTQIFFSHFLGVAEILLLVVMAYDR
YVAICKPLHYMNIMSRQVCHMLVAGSWLGGLIHSIIQILITIPLPFCGPNVIDHYFCDLQ
PLFKLACTDTFL/GVIVMANSGLISIISLFILVSSYAIILVSLRNHSAEGRHKALATCA
SHITVVILFFGPAIFIYLRPSSSFTEDKLVSVFYTVITPMLNPIIYTLRNAEVKNAVRKL
WGKRDTEIE