Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4b1b Olfactory Receptor

Gene Symbol Or4b1b
Organism Mouse
Family 4
Subfamily b
Pseudo No
Location chr2:90281650-90282573 (-)
Aliases Olfr1272, RP23-226K16.7, MOR227-3, RP23-226K16.7, MOR227-3

Sequence information


Nucleotide sequence

ATGGCCAACAAAAATAATATAACCGAGTTAATTTTCACTGGCCTTTTCCAGGATCCAGAG
GTTCAGAAGGTGTGCTTTGTGCTGTTCCTTCCTGTGTACCTGGCCACATTGCTGGGCAAC
AGTCTTATTGTTGTGGCAGTCAGCATCAGTAAGACTTTACATTCTCCCATGTACTTCTTC
CTCAGTTCCTTGTCCCTGGTGGAGATCTGTTACTCCTCTACAATTGTCCCTAAGTTCATC
ACTGACTTACTTGTTAAGGTTAAAACCATCTCCCTGAAGGGCTGTCTGGCTCAGATATTC
TTCTCCCATTTCTTGGGGGTTGCTGAGATTCTCCTGCTTGTGGTGATGGCTTATGACCGC
TATGTGGCCATCTGCAAACCTCTTCATTACATGAACATCATGAGTCGTCAAGTGTGTCAC
ATGTTGGTGGGTGGCTCCTGGCTGGGGGGCCTCATTCACTCCATAATCCAGATCATCATC
ACTATTCCATTGCCCTTCTGTGGTCCCAATGTGATTGACCACTACTTCTGTGACCTGCAG
CCATTATTTAAGCTTGCCTGCACTGACACCTTTATGGAAGGTGTTGTTGTGATGGCCAAC
AGTGGTTTAATCTCTATAATCTCTCTTTTCATCTTGGTGTCCTCTTATGCTATCATTCTA
ATCAGCTTGAGGAAGCATTCTGCAGAGGGAAGACGCAAGGCCCTCTCCACATGTGCCTCT
CACATCACAGTGGTCATCCTGTTCTTTGGACCTGCCACCTTCCTTTATCTGCGACCATCC
TCCAGCTTCACTGAAGATAAGCTTGTGGCTGTGTTCTACACAGTCATCACCCCCATGCTG
AACCCTATCATCTATACTCTCAGAAATGCAGAGGTGAAAAATGCCATGAAGAAATTGTGG
GGCAAAAGGAACCCAGAGACAGAG


Conceptual translation

MANKNNITELIFTGLFQDPEVQKVCFVLFLPVYLATLLGNSLIVVAVSISKTLHSPMYFF
LSSLSLVEICYSSTIVPKFITDLLVKVKTISLKGCLAQIFFSHFLGVAEILLLVVMAYDR
YVAICKPLHYMNIMSRQVCHMLVGGSWLGGLIHSIIQIIITIPLPFCGPNVIDHYFCDLQ
PLFKLACTDTFMEGVVVMANSGLISIISLFILVSSYAIILISLRKHSAEGRRKALSTCAS
HITVVILFFGPATFLYLRPSSSFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKNAMKKLW
GKRNPETE