Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4b1c Olfactory Receptor

Gene Symbol Or4b1c
Organism Mouse
Family 4
Subfamily b
Pseudo No
Location chr2:90,296,000-90,296,900 (-)
Aliases Olfr1273

Sequence information


Nucleotide sequence

MASVNVTELIITGLFQDPDVQKVCFVLFLPVYLATVLGNGLIVVTISVSKSLNSPMYIFL
SSLSIVEICYSSTVVPKFITDLLAKVKTISLKGCLTQIFFFHFLGVAEILLLVVMAYDRY
VAICKPLHYMNIMSRQVCHMLVGGSWLGGLIHSIIQIVITIPLPFCGPNVIDHYFCDLQP
LFKLACTDTFMEGVVVMANSGLISIISLFILVSSYAIILISLRKHSAEGRRKALSTCASH
ITVVILFFGPATFLYLRPSSSFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKNAMKKL


Conceptual translation

MASVNVTELIITGLFQDPDVQKVCFVLFLPVYLATVLGNGLIVVTISVSKSLNSPMYIFL
SSLSIVEICYSSTVVPKFITDLLAKVKTISLKGCLTQIFFFHFLGVAEILLLVVMAYDRY
VAICKPLHYMNIMSRQVCHMLVGGSWLGGLIHSIIQIVITIPLPFCGPNVIDHYFCDLQP
LFKLACTDTFMEGVVVMANSGLISIISLFILVSSYAIILISLRKHSAEGRRKALSTCASH
ITVVILFFGPATFLYLRPSSSFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKNAMKKL