Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4b1c Olfactory Receptor

Gene Symbol Or4b1c
Organism Rat
Family 4
Subfamily b
Pseudo No
Location chr3:79164778-79165698 (-)
Aliases Olr744, Olr744

Sequence information


Nucleotide sequence

ATGGCTAGTATAAATGTGACTGAGTTGATCATCACCGGCCTTTTCCAGGACCCAGAGATT
CAGAAGGTGTGCTTTGTGCTGTTCCTTCCTGTGTACCTGGCTACAGTGTTGGGCAATGGC
CTCATTGTTGTGACAATTAGTGTCAGTAAGACTTTACATTCTCCCATGTACGTCTTCCTC
AGCTCCTTGTCCCTAGTGGAGATCTTCTACTCCTCTACTGTCGTCCCTAAGTTCATCACC
GACTTACTTGCTAAGGTTAAAACCATCTCACTGAAGGGCTGTCTGGTTCAGATATTCTTC
TTCCATTTTTTGGGGGTCGCTGAGATTCTCCTCCTTGTGGTGATGGCCTATGACCGCTAC
GTGGCCATCTGCAAACCTCTTCATTACATGAACATCATGAGTCGTCAAGTATGTCACATG
CTGGTGGCTGGTTCCTGGCTGGGGGGCCTCATTCACTCCATAATCCAGATCCTCATCACC
ATCCCATTGCCCTTCTGCGGTCCCAATGTGATTGACCACTACTTCTGTGACCTGCAGCCA
TTATTCAAGCTTGCCTGCACTGACACCTTTCTGGAGGGGGTTATTGTGATGGCCAACAGT
GGTCTAATCTCTATAATCTCTCTCTTCATCTTGGTGTCCTCCTATGCCATCATTTTAGTC
AGCTTGAGGAACCATTCTGCAGAGGGGAGGCGCAAGGCCCTCTCCACTTGTGCCTCTCAC
ATCATGGTGGTCACCCTGTTTTTTGGACCTGCCATCTTCCTTTATCTGCGACCCTCCTCT
ACTTTCACTGAAGACAAGCTTGTGGCTGTGTTCTACACGGTCATCACCCCCATGCTGAAC
CCTATCATCTATACACTGAGAAATGCAGAGGTGAAAAATGCTGTGAGAAAGTTGTGGAGC
AAAAAGGACTCAGAGACAGAG


Conceptual translation

MASINVTELIITGLFQDPEIQKVCFVLFLPVYLATVLGNGLIVVTISVSKTLHSPMYVFL
SSLSLVEIFYSSTVVPKFITDLLAKVKTISLKGCLVQIFFFHFLGVAEILLLVVMAYDRY
VAICKPLHYMNIMSRQVCHMLVAGSWLGGLIHSIIQILITIPLPFCGPNVIDHYFCDLQP
LFKLACTDTFLEGVIVMANSGLISIISLFILVSSYAIILVSLRNHSAEGRRKALSTCASH
IMVVTLFFGPAIFLYLRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKNAVRKLWS
KKDSETE