Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c1 Olfactory Receptor

Gene Symbol Or4c1
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89302652-89303590 (-)
Aliases Olfr1231, RP23-82L23.10, MOR235-2, RP23-82L23.10, MOR235-2

Sequence information


Nucleotide sequence

ATGGAGCTCCACAGTCCTCCCAGTAATGTGACTGAATTTGTTCTCCTGGGTCTCACACAG
AATCCACGCTTGCAAAAAATACTGTTCATTGTCTTTTTGTTTGTTTTCCTATTTACCGTG
TTGGCTAATCTGCTCATTGTCCTCACCATCTCCTTCAGCCCCACCCTTTCAGCTCCAATG
TACTTCTTTCTCACTTACTTGTCCTTTATAGATGCCTTCTACACCTCTGTTACCACCCCC
AAAATGATAATTGACCTTCTCTACCAGAGGAGGACAATATCCTTGGCTGGATGTCTGACT
CAGCTCTTTGTGGAGCACTTCCTGGGAGGATCAGAGATTATCCTCCTCATTGTTATGGCC
TATGACCGCTACGTGGCCATATGCAAACCTCTGCATTATATGACCATTATGCGTCAAGGC
CTCTGCAGACTCCTGGTGGTGGTAGCCTGGATTGGAGGGATCTTACATGCCACCATGCAA
ATATTTTTTATGATTAATCTGCCCTTCTGTGGCCCCAATGTCATTGACCACTTCATGTGT
GATCTCTTCCCATTGTTGAAACTTGCCTGCAGAGACACACATAAGCTGGGCATCATAGTG
GCCGCCAACAGTGGGGCTATGTGCTTTCTCATTTTTACCATGCTTCTCATCTCATACATA
GTTATCCTGCGATCCTTGAAGTCTCATAGTTCTGAAGGGAGACGCAAAGCTCTTTCCACG
TGTGGCTCTCACTGTACTGTGGTGGTTCTCTTCTTTGTCCCTTGCATATTTACTTACATG
CGCCCTGTGACTACCTACCCAGTGGATAAGCTGGTGACTGTGTTTTTTGCAATTCTCACT
CCCATGTTAAATCCCATCATTTACACAGCAAGAAACACGGAGGTGAAGAACGCTATGAGG
AATCTATTGAAGAGGCAAGTCACTTACCCTGTTCTAAAA


Conceptual translation

MELHSPPSNVTEFVLLGLTQNPRLQKILFIVFLFVFLFTVLANLLIVLTISFSPTLSAPM
YFFLTYLSFIDAFYTSVTTPKMIIDLLYQRRTISLAGCLTQLFVEHFLGGSEIILLIVMA
YDRYVAICKPLHYMTIMRQGLCRLLVVVAWIGGILHATMQIFFMINLPFCGPNVIDHFMC
DLFPLLKLACRDTHKLGIIVAANSGAMCFLIFTMLLISYIVILRSLKSHSSEGRRKALST
CGSHCTVVVLFFVPCIFTYMRPVTTYPVDKLVTVFFAILTPMLNPIIYTARNTEVKNAMR
NLLKRQVTYPVLK