Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c1 Olfactory Receptor

Gene Symbol Or4c1
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:78111844-78112770 (-)
Aliases Olr694, Olr694

Sequence information


Nucleotide sequence

ATGGAGCTCCACAGTCCTACCAGTAATGTGACTGAGTTTGTTCTCCTGGGTCTCACACAG
AATCCAAGCTTGCAGAAAATACTGTTCATTGTCTTTTTGTTTGTTTTCCTGTTTACTGTG
TTGGCTAATTTGCTCATTGTCCTCACCATCTCCTTCAGCCCCACCCTTTCAGCTCCCATG
TACTTCTTTCTCACTTACTTATCCTTCATTGATGCCTTCTACACCTCCGTCACCACCCCC
AAAATGATAATTGACCTCCTCTACCAGAGGAGAACAATATCCTTGGCTGGCTGTCTGACT
CAGCTTTTTGTGGAGCACTTCCTTGGAGGATCAGAGATTATCCTTCTCATTGTTATGGCC
TATGACCGTTATGTAGCCATATGCAAACCTTTGCATTACATGACCATTATGGGTCAAGGC
CTCTGTAGAATCCTGGTGGTGGTAGCCTGGACTGGAGGGATCTTGCATGCTACCATGCAA
ATATTTTTTATGATTAATTTGCCATTCTGTGGGCCCAATATCATCGACCACTTCATGTGT
GATCTCTTCCCATTGTTGAAACTTGCCTGCAGAGACACGCACAGGCTGGGCATCATAGTG
GCTGCCAACAGCGGGGCCATGTGCTTGCTCATATTTACCATGCTCCTCATCTCATACATA
GTTATCCTGCAATCCCTGAAGTCTCATAGTTCTGAAGGGAGACGCAAAGCTCTTTCCACG
TGTGGCTCTCACTTTACTGTGGTTGTTCTCTTCTTTGTACCTTGCGTATTCACTTACATG
CGTCCTGTGACCACCTACCCTGTGGACAAGCTGGTGACTGTGTTCTTTGCAATCCTCACT
CCCATGTTAAATCCCATCATTTACACAGCAAGAAACACGGAAGTGAAGAATGCTATGAAG
AATCTATTGAAGAAGCGAGTCACTTAG


Conceptual translation

MELHSPTSNVTEFVLLGLTQNPSLQKILFIVFLFVFLFTVLANLLIVLTISFSPTLSAPM
YFFLTYLSFIDAFYTSVTTPKMIIDLLYQRRTISLAGCLTQLFVEHFLGGSEIILLIVMA
YDRYVAICKPLHYMTIMGQGLCRILVVVAWTGGILHATMQIFFMINLPFCGPNIIDHFMC
DLFPLLKLACRDTHRLGIIVAANSGAMCLLIFTMLLISYIVILQSLKSHSSEGRRKALST
CGSHFTVVVLFFVPCVFTYMRPVTTYPVDKLVTVFFAILTPMLNPIIYTARNTEVKNAMK
NLLKKRVT