Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c100 Olfactory Receptor

Gene Symbol Or4c100
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:88525585-88526493 (+)
Aliases Olfr1186, RP23-209L8.7, MOR230-5, RP23-209L8.7, MOR230-5

Sequence information


Nucleotide sequence

ATGTATAACCATACGATGACTGAATTCATTCTGTTTGGGTTGACACAGGATCCAGAACAA
CAGAAGGCAATATTTGGAGTCTTCTTGATTCTTTACCTTATGACTTTAATGGGGAACTTT
CTCATAATGGTGACCATTAAGATGAGTCAGACACTTGGGAGTCCCATGTACTTTTTCCTC
TTCTATTTATCTTTCGCTGATGCTTGCTTCTCTACAACTACAGCACCTAGATTGATTGCA
GATGCCCTATTGCAGAAAAAAATCATTACCTATAATGAATGTATGACTCAGGTCTTTGCA
GTTCACTTCTTTGGGTGCATGGAGATCTTTGTGCTTATCCTCATGGCCTTTGACCGCTAT
GTAGCAATCTGTAAGCCTCTAAGATATACAGCTATAATGAGCCAACATATCTGTGGTGTA
TTAGTGATTCTTGCCTGGATAGGGTCGTGTATTCACTCTTCAGCACAGATTTTCTTAGCC
TTAAGACTACCATTCTGTGGCCCAAATGTGATTGATCACTATTTCTGTGATTTGCAGCCC
TTACTGAAACTTGCCTGCATGGATACTTATGTGATAAATCTGCTAGTTGTATCTAATAGT
GGTGCAATATGTACGGTAAGTTTCATAGTACTGCTTATCTCCTATATTGTAATCTTATAC
TCTCTGAGAAGCCACAGTGCAGAAGGAAGACGAAAGGCCTTGTCTACATGCACTTCTCAT
ATCATTGTGGTGATCTTATTTTTTGGTCCTTGTATATTTATATACACATGGCCACCAACC
ACTTTTCCAATAGACAAAATGGTATCTTTGTTTTATACAATTGGAACACCTGTGCTCAAC
CCTCTTATCTATACTCTGAGGAATGCAGAAGTAAAACATGCCATGAAAAAGTTATGGGGT
AATAAAGTG


Conceptual translation

MYNHTMTEFILFGLTQDPEQQKAIFGVFLILYLMTLMGNFLIMVTIKMSQTLGSPMYFFL
FYLSFADACFSTTTAPRLIADALLQKKIITYNECMTQVFAVHFFGCMEIFVLILMAFDRY
VAICKPLRYTAIMSQHICGVLVILAWIGSCIHSSAQIFLALRLPFCGPNVIDHYFCDLQP
LLKLACMDTYVINLLVVSNSGAICTVSFIVLLISYIVILYSLRSHSAEGRRKALSTCTSH
IIVVILFFGPCIFIYTWPPTTFPIDKMVSLFYTIGTPVLNPLIYTLRNAEVKHAMKKLWG
NKV