Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c101-ps Olfactory Receptor

Gene Symbol Or4c101-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:76,975,900-76,977,200 (+)
Aliases Olr644-ps

Sequence information


Conceptual translation

MNVTEFILMGLTQNPQVQRILFF\LLITYIITVTGNLLIVGTIVCSQSLNSPMYFFLAF
LSLIDACYSSCTIPKMLADLLSGTKTISFNGCILQLFVEHFLGASEIVLLVVMAYDRYVA
ICRPLHYVSRMNHHTCCLLVGICWIVGFLHSFGQILVTFWIPFCGPNILDHFFCDIFPLL
QHACNDTFLLGLLAAANGGVIPVITFTMLLMSYVVILYSLKAHNPAGRTKALSTCGSHIT
VVVLFFVPCIFMYMRPVAIFPRDKAIAVFYIIITPLLNPVIYTVRNAEVKNAIRMLLKRM
HFCVAPTSTGKEDATPLDPSQSAF