Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c101 Olfactory Receptor

Gene Symbol Or4c101
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:88559471-88560406 (+)
Aliases Olfr1188, RP23-316D8.1, MGC123611, MGC123612, MOR238-2, RP23-316D8.1, MGC123611, MGC123612, MOR238-2

Sequence information


Nucleotide sequence

ATGCCCAACAGCATTCAACTGAGAGAAAAGAGAATGAACGTGACTGAATTCATCCTCATG
GGACTAACACAGAATCCCCAGCTTCAGAGAATTCTATTTTTTGTGTTACTCATCACCTAC
ATCATTACTGTCACAGGAAACCTGCTCATAGTGGGGACCATAGTCTGTAGCCAGTCTTTG
AACTCCCCAATGTACTTTTTCTTGACTTTTTTATCTCTGATAGATGCATGTTATTCCTCT
TGCACAATCCCTAAGATGCTGGTAGATTTGCTCTCAGAAACAAAAACCATCTCATTCAAT
GGCTGCATATTGCAACTTTTTGTTGAACATTTCTTAGGAGCTTCAGAGATTGTCCTTCTT
GTGGTTATGGCCTATGACCGCTATGTGGCCATCTGCAGACCTCTGCACTATGCCTCCAGG
ATGAACCACCATATGTGCTGTCTTCTAGTGGGAATATGTTGGATAGTGGGTTTTCTACAT
TCCTTTGGTCAGATACTTGTTACTCTCTGGATTCCCTCCTGTGGCCCCAATATCTTGGAT
CACTTCTTTTGTGACATCTTCCCCTTGCTACAACTTGCCTGCACTGACACTTTCCTTCTT
GGACTCCTGGTTGCTTGCAATGGTGGTGTAATCCCTGTGATCACCTTCACGATGCTATTG
ATGTCCTATGCAGTCATTCTTTACTCCTTGAGAACACATAGCACTGCAGGGAGGAAAAAG
GCCCTCTCTACCTGTGGCTCTCACATCACAGTTGTTGTATTGTTTTTTGTGCCATGTATT
TTTATGTATATGCGACCAGTGGCAACCTTTCCCATGGATAAAGCAATAGCCGTGTTTTAT
ATCATCATCACACCTTTGTTAAATCCTGTTATCTACACTGTAAGGAACGCAGAGGTAAAA
AGTGCCATTAGAATGCTCTTAAAAAGAATGCACTTG


Conceptual translation

MPNSIQLREKRMNVTEFILMGLTQNPQLQRILFFVLLITYIITVTGNLLIVGTIVCSQSL
NSPMYFFLTFLSLIDACYSSCTIPKMLVDLLSETKTISFNGCILQLFVEHFLGASEIVLL
VVMAYDRYVAICRPLHYASRMNHHMCCLLVGICWIVGFLHSFGQILVTLWIPSCGPNILD
HFFCDIFPLLQLACTDTFLLGLLVACNGGVIPVITFTMLLMSYAVILYSLRTHSTAGRKK
ALSTCGSHITVVVLFFVPCIFMYMRPVATFPMDKAIAVFYIIITPLLNPVIYTVRNAEVK
SAIRMLLKRMHL