Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c103 Olfactory Receptor

Gene Symbol Or4c103
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:***************** (-)
Aliases Olfr1195, RP23-316D8.7, MOR230-4, RP23-316D8.7, MOR230-4

Sequence information


Nucleotide sequence

ATGCAGCTGAATATCAATGTGACAGAGTTCATTCTTCTTGGATTGACACAGGACCCCAGC
AGGAAGAACATAGTGTTTGCCATTTTCCTGTTCTTTTATATGGGGACATTACTAGGTAAT
TTCCTTATCATTGTTACTATTAAGACAAGCCCGGCCCTTGGGAGTCCCATGTACTTCTTC
CTGTTCTACTTATCCTTGTCTGACACCTGCTTCTCAACAACTGTAGCCCCGAGAACAATT
GTGGATTCCCTGCTGAAAGAGGCCTCTATCTCTTTCAATGAGTGCATAATCCAAGTCTTC
ACGTTTCATTTATTTGGTTCCCTGGAGATCTTTATCCTCATCCTCATGGCTGTTGACCGC
TATGTGGCCATCTGTAAGCCTCTGCACTATATGACCATCATGAATCGCCAGGTCTGTGGA
ATGCTGGTGGCCACAGTCTGTGTGGGATCCTGTATACATTCATCAGTTCAGATAATTCTG
GCCTTGAGTTTACCTTTCTGTGGTCCCAATGAGATTGATCACTATTTCTGTGACTTACAG
CCACTGTTGAAACTTGCCTGTTCCGACACATATGTGATCAACCTTCTCCTGGTGTCCAAT
AGTGGAACCCTTTGTACAGTGAGTTTCCTTATGCTCATGGTCTCATATATCATTATTCTC
TATTCTTTGAGGAATCACAGTGCTGAGGGGAGGAGAAAAGCTCTGTTCACTTGTGTCTCT
CATATCATAGTAGTCATTTTGTTTTTTGTGCCCTGCATATTTATATACACACGTCCTGCC
ACCACCTTCCCTATGGACAAGATGATATCTGTGTTTTATACAATTTGTACACCTTTCCTA
AACCCTCTGATTTACACACTGAGGAATGCAGAGGTGAAAAATGCCATGAGGAAGTTGTGG
AGCAAAAAAATTTCTGATGATATA


Conceptual translation

MQLNINVTEFILLGLTQDPSRKNIVFAIFLFFYMGTLLGNFLIIVTIKTSPALGSPMYFF
LFYLSLSDTCFSTTVAPRTIVDSLLKEASISFNECIIQVFTFHLFGSLEIFILILMAVDR
YVAICKPLHYMTIMNRQVCGMLVATVCVGSCIHSSVQIILALSLPFCGPNEIDHYFCDLQ
PLLKLACSDTYVINLLLVSNSGTLCTVSFLMLMVSYIIILYSLRNHSAEGRRKALFTCVS
HIIVVILFFVPCIFIYTRPATTFPMDKMISVFYTICTPFLNPLIYTLRNAEVKNAMRKLW
SKKISDDI