Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c104 Olfactory Receptor

Gene Symbol Or4c104
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:88755744-88756673 (-)
Aliases Olfr1199, RP24-386K1.3, MOR230-8, RP24-386K1.3, MOR230-8

Sequence information


Nucleotide sequence

ATGCAGCTGAATATCAATGTGACAGAGGTTATTCTTCTTGGCTTGACACAGGACCCCAGC
AGGAAGAACATAGTGTTTGCCATTTTCCTGCTCTTTTACATGGGGACCTTACTGGGCAAC
TTGCTTATCATTGTTACTGTCAAGACAAGCCAGGCTCTTGGGAGTCCCATGTATTTCTTC
CTGTTCTACTTATCCTTGTCTGACACCTGCTTCTCTACAACTGTAGCTCCTAGAACAATT
GTGGATTCCTTACAGAAGGAGGCCTCTATCTCTTTCACTGAGTGCATAATCCAAATCTTT
ACATTTCACTTCTTTGGCTGTCTGGAGATCTTTATCCTTATCCTCATGGCTGTGGACCGA
TATGTGGCCATCTGTAAACCCCTGCACTACATGACCATCATGAGCCGCCGGGTATGTGGG
GTGTTGGTGGCCATAGCCTGGATGGGATCCTGCGTGCATTCTTTAGTTCAGATATTCCTA
GCCTTGAGTTTGCCCTTCTGTGGCCCCAATGTGATTGATCACTATTTCTGTGACTTGCAG
CCATTATTGAAACTTGCCTGTTCAGACACATATTTGATCAACCTGCTTCTGGTGTCCAAC
AGTGGAGCCATTTGCACAGTGAGTTTCCTTGTGCTAATGTTCTCCTATGTCATTATTCTT
CATTCCCTAAGAAATCACAGTGCTGAAGGGAGGAGGAAAGCCCTATCTACCTGTATATCC
CACATTATTGTGGTCATCCTTTTCTTTGGACCTTGCATCTTTATATATACACGCCCTGCA
ACAACATTTCCTATGGACAAGATGATATCTATATTTTATTCAATTGGAACACCTCTGCTC
AATCCTCTGATTTACACACTGAGGAATGCAGAGGTGAAAAATGCTATGAAGAAGTTGTGG
AGAAAGAAAATCGTGTCAGATGATAAAAAG


Conceptual translation

MQLNINVTEVILLGLTQDPSRKNIVFAIFLLFYMGTLLGNLLIIVTVKTSQALGSPMYFF
LFYLSLSDTCFSTTVAPRTIVDSLQKEASISFTECIIQIFTFHFFGCLEIFILILMAVDR
YVAICKPLHYMTIMSRRVCGVLVAIAWMGSCVHSLVQIFLALSLPFCGPNVIDHYFCDLQ
PLLKLACSDTYLINLLLVSNSGAICTVSFLVLMFSYVIILHSLRNHSAEGRRKALSTCIS
HIIVVILFFGPCIFIYTRPATTFPMDKMISIFYSIGTPLLNPLIYTLRNAEVKNAMKKLW
RKKIVSDDKK