Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c104 Olfactory Receptor

Gene Symbol Or4c104
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:77388592-77389521 (-)
Aliases Olr657, Olr657

Sequence information


Nucleotide sequence

ATGCAGCTGAATATCAATGTGACTGAGATCATTCTTCTTGGCTTGACACAGGATCCCAGT
AGGAAGAACATTGTGTTTGCTATTTTCCTGTTCTTTTATATGGGGATATTACTAGGTAAT
TTGCTTATCATTGTTACGATCAAGACAAGCCAGGCCCTTGGGAGCCCCATGTACTTCTTC
TTGTTTTACTTATCCTTGTCTGACACTTGTTTCTCAACAACTGTAGCTCCTAGAACAATT
GTGGATTCCCTGCTGAAGGAGGCTTCTATCTCTTTCACTGAGTGCATAATCCAAGTCTTT
ACATTTCATTTCTTTGGCTGTCTGGGGATCTTTATCCTCATCCTCATGGCTGTTGACCGC
TATGTGGCCATCTGTAAGCCCCTACACTATATGACCATCATGAGCCACCGGGTCTGTGGG
GTGTTGGTGGCTTTAGCCTGGGTGGGATCCTGTGTGCATTCTTTAGTGCAGATATTTCTG
GCCTTGAGTTTGCCCTTCTGTGGTCCCAATGTGATTGATCACAATTTTTGTGATTTGCAG
CCACTATTGAAACTAGCCTGTTCAGACACATACATGATCAACCTGCTTCTGGTGTCCAAC
AGTGGAGCCATTTGTACAGTGAGTTTTCTCATGCTGATGGTCTCCTATGTCATTATTCTT
CATTCCCTAAGAAACCACAGTGCTGAGGGGAGGAGGAAAGCTCTATCCACCTGCATATCC
CACATTATTGTGGTTATCATTTTCTTTGGACCATGCATCTTTATATATACACGTCCTGCA
ACAACATTTCCTTTGGACAAGATGGTATCTATATTTTACTCAATTGGAACACCTTTTCTC
AATCCTTTGATTTACACACTGAGAAATGCAGAGGTGAAAAATGCAATGAAGAAATTATGG
AGAAGGAAAGTGGTCTCAGATGATAGAAAG


Conceptual translation

MQLNINVTEIILLGLTQDPSRKNIVFAIFLFFYMGILLGNLLIIVTIKTSQALGSPMYFF
LFYLSLSDTCFSTTVAPRTIVDSLLKEASISFTECIIQVFTFHFFGCLGIFILILMAVDR
YVAICKPLHYMTIMSHRVCGVLVALAWVGSCVHSLVQIFLALSLPFCGPNVIDHNFCDLQ
PLLKLACSDTYMINLLLVSNSGAICTVSFLMLMVSYVIILHSLRNHSAEGRRKALSTCIS
HIIVVIIFFGPCIFIYTRPATTFPLDKMVSIFYSIGTPFLNPLIYTLRNAEVKNAMKKLW
RRKVVSDDRK