Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c105 Olfactory Receptor

Gene Symbol Or4c105
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:88817173-88818099 (+)
Aliases Olfr1202, RP23-350F2.3, MOR232-7, RP23-350F2.3, MOR232-7

Sequence information


Nucleotide sequence

ATGGAAATTAAGAACAACGTGACCGAGTTTGTTCTCCTGGGGCTCACACAGAATCTGCAC
TTGCAAAAAATAGTATTTGTTGTGTTTTTGGTTATCTATGTTTTCTCTGTGGTAGGAAAT
TTGCTCATTGTAATCACCATTACAAACAGCCAACTGTTGGGGTACCCTATGTATTACTTC
CTGGCCTATCTCTCTTTTATTGATGCTTGCTACTCCTCTGTCAATACACCTAAAGTGATT
GCTGATTCACTACATAAAAGGAAGTCTATTAAATTCAATGGATGCATGACCCAAGTTTTT
GCAGAACATTTCATTGGAGGAACTGAAGTCATCTTGCTTACTGTGATGGCTTATGACCGC
TATGTAGCCATCTGTAAACCCCTGCACTATGCAACCATCATGAACAGACAACTCTGTAAC
ATCCTAGTGGGAGTGTCATGGGTTGGAGGCTTTCTTCATGGAGGTATACAAATTCTTTTC
ATTATTGGATTACCTTTCTGTGGCCCTAATGTCATAGACCATTTTATGTGTGATCTGAAC
CCTTTGCTTGATCTAGCCTGTATTGACACCCACATCCTGGGGCTTTTTGTTGCTGCCAAC
AGTGGTTTCATTTGTCTGTTAAATTTCCTCCTACTGCTTGTCTCCTACCTGGTCATTCTT
AACTCCCTAAGGAGCCACAGTGCAGAAGGCAGGCGCAAAGCCCTCTCTACCTGTGTTTCT
CACATTACAGTAGTGGTTTTATTTTTTGTGCCCTGCATATTTGTGTACATGAGACCTGTA
GCTACATTACCCATTGATAAAGCAGTTACTTTGTTTTATACTATGATAACTCCCATGTTG
AATCCATTAATCTATACCTTAAGAAATGCTCAGATGAAAAATGCCATTTGGAAATTGTTT
AGTGTAAAAGTTCAGTCAGATGACAAA


Conceptual translation

MEIKNNVTEFVLLGLTQNLHLQKIVFVVFLVIYVFSVVGNLLIVITITNSQLLGYPMYYF
LAYLSFIDACYSSVNTPKVIADSLHKRKSIKFNGCMTQVFAEHFIGGTEVILLTVMAYDR
YVAICKPLHYATIMNRQLCNILVGVSWVGGFLHGGIQILFIIGLPFCGPNVIDHFMCDLN
PLLDLACIDTHILGLFVAANSGFICLLNFLLLLVSYLVILNSLRSHSAEGRRKALSTCVS
HITVVVLFFVPCIFVYMRPVATLPIDKAVTLFYTMITPMLNPLIYTLRNAQMKNAIWKLF
SVKVQSDDK